- Description of Target:
- RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
- Gene Symbol:
- RBM10
- Official Gene Full Name:
- RNA binding motif protein 10
- Alias Symbols:
- S1-1; TARPS; GPATC9; ZRANB5; GPATCH9; DXS8237E
- Tissue Tool:
- Find tissues and cell lines supported to express RBM10.

- Protein Accession# :
- NP_005667
- Nucleotide Accession#:
- NM_005676
- Swissprot Id:
- P98175
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 930
- Molecular Weight:
- 104kDa
- Application:
- WB, IHC
- Partner Proteins:
- EAF1, EAF2, HNRNPU, POLR2A, SNF8, TFPT, TP53, EAF1, EAF2, SIRT2, SNF8, TP53, USPL1, ZHX1
- Immunogen:
- The immunogen for anti-RBM10 antibody: synthetic peptide directed towards the N terminal of human RBM10
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- RBM10 antibody - N-terminal region (ARP30104_T100)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Dog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-RBM10 antibody
- ARP30104_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS
- Blocking Peptide:
- For anti-RBM10 antibody is Catalog # AAP30104 (Previous Catalog # AAPH00280)
- Key Reference:
- Thiselton,D.L., et al., (2002) Genomics 79 (4), 560-572
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-RBM10 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: RBM10 antibody tested with Human Daudi Cells (ARP30104_T100)
Aviva Systems Biology is the original manufacturer of this RBM10 antibody (ARP30104_T100)
Click here to view the RBM10 antibody Western Blot Protocol
Product Datasheet Link: RBM10 antibody (ARP30104_T100)
WB Suggested Anti-RBM10 Antibody Titration: 1.4ug/ml
ELISA Titer: 1:1562500
Positive Control: Daudi
Western Blot image: 
Description of Target: RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s RBM10 antibody (ARP30104_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: RBM10 antibody tested by IHC with human lung (ARP30104)
Aviva Systems Biology is the original manufacturer of this RBM10 antibody.
Click here to view the RBM10 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: RBM10 antibody (ARP30104)
IHC Information:
Rabbit Anti-RBM10 Antibody
Catalog Number: ARP30104
Paraffin Embedded Tissue: Human Lung
Cellular Data: Epithelial cells of bronchiole
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
Product Protocols: RBM10 antibody tested by IHC with human heart (ARP30104)
Aviva Systems Biology is the original manufacturer of this RBM10 antibody.
Click here to view the RBM10 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: RBM10 antibody (ARP30104)
IHC Information:
Rabbit Anti-RBM10 Antibody
Catalog Number: ARP30104
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
- Protocol:
- Tips Information:
See our General FAQ page.


