ANXA7 antibody - N-terminal region (ARP36584_T100)

Catalog#: ARP36584_T100

• Size: 100ug

Human Placenta

• Description of Target: ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle. The transcripts also differ in their 3'-non coding regions by the use of two alternative poly(A) signals. The selection of poly(A) signals is independent of the mRNA splicing pattern. Annexin VII encodes a protein with a molecular weight of approximately 51 kDa with a unique, highly hydrophobic N-terminal domain of 167 amino acids and a conserved C-terminal region of 299 amino acids. The latter domain is composed of alternating hydrophobic and hydrophilic segments. Structural analysis of the protein suggests that Annexin VII is a membrane binding protein with diverse properties including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion.
• Gene Symbol: ANXA7
• Official Gene Full Name: Annexin A7
• Alias Symbols: SNX; ANX7; SYNEXIN
• Protein Accession#: NP_001147
• Nucleotide Accession#: NM_001156
• Swissprot Id: Q5T0M6
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 466
• Molecular Weight: 51kDa
• Application: WB
• Partner Proteins: PDCD6, PRKCA, PRKCB, PRKCG, S100A10, SRI, ALG2, SRI
• Immunogen: The immunogen for anti-ANXA7 antibody: synthetic peptide directed towards the N terminal of human ANXA7
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Dog: 92%; Guinea pig: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Bovine: 85%; Mouse: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
• Blocking Peptide: For anti-ANXA7 antibody is Catalog # AAP36584 (Previous Catalog # AAPP07817)
• Key Reference: Satoh,H., et al., (2002) Biochim. Biophys. Acta 1600 (1-2), 61-67
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-ANXA7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: ANXA7 antibody tested with Human Placenta Tissue (ARP36584_T100)

Aviva Systems Biology is the original manufacturer of this ANXA7 antibody (ARP36584_T100)

Click here to view the ANXA7 antibody Western Blot Protocol

Product Datasheet Link: ANXA7 antibody (ARP36584_T100)

WB Suggested Anti-ANXA7 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Placenta

Western Blot image:


Description of Target: ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle. The transcripts also differ in their 3'-non coding regions by the use of two alternative poly(A) signals. The selection of poly(A) signals is independent of the mRNA splicing pattern. Annexin VII encodes a protein with a molecular weight of approximately 51 kDa with a unique, highly hydrophobic N-terminal domain of 167 amino acids and a conserved C-terminal region of 299 amino acids. The latter domain is composed of alternating hydrophobic and hydrophilic segments. Structural analysis of the protein suggests that Annexin VII is a membrane binding protein with diverse properties including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ANXA7 antibody (ARP36584_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com