website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

TP53 antibody - N-terminal region (ARP30311_P050)

Description of Target:
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Gene Symbol:
TP53
NCBI Gene Id:
7157
Alias Symbols:
LFS1; TRP53; p53
Sample Type Confirmation:

TP53 is strongly supported by BioGPS gene expression data to be expressed in DU145, HEK293T

Tissue Tool:
Find tissues and cell lines supported to express TP53.
Protein Accession #:
NP_000537
Nucleotide Accession#:
NM_000546
Swissprot Id:
P04637
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Cellular tumor antigen p53
Protein Size (# AA):
393
Molecular Weight:
44kDa
Application:
CHIP, IHC, WB
Partner Proteins:
BAK1, BCL6, APEX1, ATF3, ATM, ATM, ATM, ATM, ATR, AURKA, BAK1, BARD1, BAX, BAX, BAX, BCL2L1, BLM, BLM, BLM, BNIP3L, BRCA1, BRCA1, CARM1, CDC25C, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CDKN1A, CR2, CREBBP, CUL9, DDX5, DHCR24, EP300, EP300, EP300, ERCC3, ESR1, FOXO3, GPS2, GSK3B, HCVgp1, HCVgp1, HCVgp1, HCVg
Immunogen:
The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
TP53 antibody - N-terminal region (ARP30311_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Human
Datasheets / Downloads:
Printable datasheet for
anti-TP53 antibody
- ARP30311_P050
Peptide Sequence:
Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Blocking Peptide:
For anti-TP53 antibody is Catalog # AAP30311 (Previous Catalog # AAPS08801)
Additional Information:
IHC Information: Kidney
Target Reference:
Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TP53 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Customer Reviews for TP53 Antibody (ARP30311_P050) tested with U20S, PLKO cells in Chromatin Immunoprecipitation

CAT#ARP30311
-submitted by Nick Barlev
University of Leicester

U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

Computational species homology for TP53 antibody (ARP30311)

Product page for TP53 antibody (ARP30311)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Common tree shrew P53 antibody; Tupaia belangeri P53 antibody Q9TTA1 100%
Human P53 antibody; Homo sapiens P53 antibody P04637 100%
Human P53 antibody; Homo sapiens P53 antibody P04637-3 100%
Human P53 antibody; Homo sapiens P53 antibody P04637-2 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q2XSC7 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q1MSX0 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q1MSW9 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q1MSW8 100%
Human TP53 antibody; Homo sapiens TP53 antibody Q0ZAK1 100%
Human TP53 antibody; Homo sapiens TP53 antibody E9PFT5 100%
Human TP53 antibody; Homo sapiens TP53 antibody E9PCY9 100%
Human TP53 antibody; Homo sapiens TP53 antibody E7EQX7 100%
Human TP53 antibody; Homo sapiens TP53 antibody E7EMR6 100%
Human TP53 antibody; Homo sapiens TP53 antibody E5RMA8 100%
Lowland gorilla ENSG00000141510 antibody; Gorilla gorilla gorilla ENSG00000141510 antibody G3R2U9 100%
Northern white-cheeked gibbon LOC100583326 antibody; Nomascus leucogenys LOC100583326 antibody G1RF61 100%
Northern white-cheeked gibbon TP53 antibody; Nomascus leucogenys TP53 antibody G1RF70 100%
Northern white-cheeked gibbon TP53 antibody; Nomascus leucogenys TP53 antibody G1RF69 100%
Northern white-cheeked gibbon TP53 antibody; Nomascus leucogenys TP53 antibody G1RF65 100%

Product Protocols: TP53 antibody tested with Human 293T Cells (ARP30311_P050)

Aviva Systems Biology is the original manufacturer of this TP53 antibody (ARP30311_P050)

Click here to view the TP53 antibody Western Blot Protocol

Product Datasheet Link: TP53 antibody (ARP30311_P050)

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T

Western Blot image:


Description of Target: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TP53 antibody (ARP30311_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: TP53 antibody – N-terminal region (ARP30311_P050) in PLKO AND U2OS cells using ChIp Assays

Product Page Link: TP53 antibody - N-terminal region (ARP30311_P050)

Data provided by: Dr. Barlev, University of Leicester

Figure 1. Binding of p53-specific antibodies to the p21 promoter. U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

Product Review: TP53 antibody - N-terminal region (ARP30311_P050) in DU145 cells using Western Blot

Product Page for TP53 Antibody N-terminal region (ARP30311_P050)

Data Provided by Dr. Andrei Gartel, University of Illinois at Chicago

DU145 cells were lysed in IP lysis buffer: 20 mM HEPES, 1% Triton X-100, 150 mM NaCl, 1 mM EDTA, 1 mM EGTA, 100 mM NaF, 10 mM Na4P2O7, 1 mM Na3VO4, 0.2 mM PMSF

Amount of Protein per well: 30 ug

Primary antibody conditions: 1:2000 in 5% milk/TBST buffer, overnight at 4°C

Secondary antibody conditions: 1 to 5000 in 5% milk/TBST buffer, 1 hour at room temperature

 
X
Ask a Question