website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

TP53 antibody - N-terminal region (ARP30311_P050)

Description of Target:
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Gene Symbol:
NCBI Gene Id:
Alias Symbols:
LFS1; TRP53; p53
Sample Type Confirmation:

TP53 is strongly supported by BioGPS gene expression data to be expressed in DU145, HEK293T

Tissue Tool:
Find tissues and cell lines supported to express TP53.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Cellular tumor antigen p53
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
TP53 antibody - N-terminal region (ARP30311_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Species Reactivity:
Datasheets / Downloads:
Printable datasheet for
anti-TP53 antibody
- ARP30311_P050
Peptide Sequence:
Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Blocking Peptide:
For anti-TP53 antibody is Catalog # AAP30311 (Previous Catalog # AAPS08801)
Additional Information:
IHC Information: Kidney
Key Reference:
Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-TP53 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question