website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/7/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

TP53 antibody - N-terminal region (ARP30307_P050)

Description of Target:
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Gene Symbol:
TP53
NCBI Gene Id:
7157
Alias Symbols:
LFS1; TRP53; p53
Sample Type Confirmation:

TP53 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TP53.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TP53.
Swissprot Id:
P04637
Protein Accession #:
NP_000537
Nucleotide Accession #:
NM_000546
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Cellular tumor antigen p53
Protein Size (# AA):
393
Molecular Weight:
44kDa
Application:
CHIP, IHC, WB
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TP53
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-TP53 (ARP30307_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 80%; Guinea Pig: 90%; Horse: 90%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 90%; Sheep: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Pig; Rabbit; Rat; Sheep
Datasheets / Downloads:
Printable datasheet for anti-TP53 (ARP30307_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Blocking Peptide:
For anti-TP53 (ARP30307_P050) antibody is Catalog # AAP30307 (Previous Catalog # AAPS08710)
Additional Information:
IHC Information: Skin
IHC Information: Kidney
Target Reference:
Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Customer Reviews for TP53 Antibody (ARP30307_P050) tested with U20S, PLKO cells in Chromatin Immunoprecipitation

CAT#ARP30307
-submitted by Nick Barlev
University of Leicester

U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. The data for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

Product Protocols: TP53 antibody tested with Human 293T Cells (ARP30307_P050)

Aviva Systems Biology is the original manufacturer of this TP53 antibody (ARP30307_P050)

Click here to view the TP53 antibody Western Blot Protocol

Product Datasheet Link: TP53 antibody (ARP30307_P050)

WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T

Western Blot image:


Description of Target: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TP53 antibody (ARP30307_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: TP53 antibody – N-terminal region (ARP30307_P050) in PLKO AND U2OS cells using ChIp Assays

Product Page Link:  TP53 antibody - N-terminal region (ARP30307_P050)

Data provided by: Dr. Barlev, University of Leicester

Figure 1. Binding of p53-specific antibodies to the p21 promoter. U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies).

 
X
Ask a Question