website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Sumo1 antibody - N-terminal region (ARP30639_P050)

  • Catalog#: ARP30639_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP30639_P050-FITC Conjugated

    ARP30639_P050-HRP Conjugated

    ARP30639_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    Sumo1
    NCBI Gene Id:
    22218
    Official Gene Full Name:
    SMT3 suppressor of mif two 3 homolog 1 (yeast)
    Protein Name:
    Small ubiquitin-related modifier 1
    Swissprot Id:
    P63166
    Protein Accession #:
    NP_033486
    Nucleotide Accession #:
    NM_009460
    Alias Symbols:
    GMP1, MGC103203, PIC1, SENTRIN, SMT3, SMT3H3, SMTP3, SUMO-1, Smt3C, Ubl1
    Replacement Item:
    This antibody may replace item sc-130275 from Santa Cruz Biotechnology.
    Description of Target:
    Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development.
    Protein Size (# AA):
    101
    Molecular Weight:
    11kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express Sumo1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express Sumo1.
    Species Reactivity:
    Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-Sumo1 (ARP30639_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Pten; Stat1; Pml; Casp8ap2; Traf3; Pik3c3; Npm1; Mdm2; Ube2i; Trp53; Rangap1; Ranbp2; Mthfs; Sox2; Senp2; Rbbp7; Slc1a2; Uimc1; Nfatc2ip; Irf1; Irf8; Smad4; BCL11A; AXIN1; Myb; Pax6; Sept2; Daxx; Sf1; Sp3; Pou5f1; Hif1a; Nfkb2; Junb; Jun;
    Blocking Peptide:
    For anti-Sumo1 (ARP30639_P050) antibody is Catalog # AAP30639 (Previous Catalog # AAPP01292)
    Datasheets / Downloads:
    Printable datasheet for anti-Sumo1 (ARP30639_P050) antibody
     
    X
    Ask a Question