website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

Sumo1 antibody - N-terminal region (ARP30639_P050)

Description of Target:
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development.
Gene Symbol:
Sumo1
Official Gene Full Name:
SMT3 suppressor of mif two 3 homolog 1 (yeast)
NCBI Gene Id:
22218
Alias Symbols:
GMP1; MGC103203; PIC1; SENTRIN; SMT3; SMT3H3; SMTP3; SUMO-1; Smt3C; Ubl1
Tissue Tool:
Find tissues and cell lines supported to express Sumo1.
Protein Accession #:
NP_033486
Nucleotide Accession#:
NM_009460
Swissprot Id:
P63166
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Small ubiquitin-related modifier 1
Protein Size (# AA):
101
Molecular Weight:
11kDa
Application:
WB
Partner Proteins:
Jun,Junb,Hif1a,Nfkb2,Pou5f1
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
Sumo1 antibody - N-terminal region (ARP30639_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%
Species Reactivity:
Pig, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Bovine, Goat
Datasheets / Downloads:
Printable datasheet for
anti-Sumo1 antibody
- ARP30639_P050
Peptide Sequence:
Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC
Blocking Peptide:
For anti-Sumo1 antibody is Catalog # AAP30639 (Previous Catalog # AAPP01292)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Sumo1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for Sumo1 antibody (ARP30639)

Product page for Sumo1 antibody (ARP30639)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog MGC85025 antibody; Xenopus laevis MGC85025 antibody B7ZQM3 85%
African clawed frog SMO1A antibody; Xenopus laevis SMO1A antibody O57686 85%
African clawed frog SMO1B antibody; Xenopus laevis SMO1B antibody Q5EAX4 92%
African elephant SUMO1 antibody; Loxodonta africana SUMO1 antibody G3TP58 100%
Bovine LOC788060 antibody; Bos taurus LOC788060 antibody G3MZL6 92%
Bovine SUMO1 antibody; Bos taurus SUMO1 antibody Q5E9D1 100%
Chicken SUMO1 antibody; Gallus gallus SUMO1 antibody Q8QGH2 92%
Chicken SUMO1 antibody; Gallus gallus SUMO1 antibody F1P3Q1 92%
Common turkey SUMO1 antibody; Meleagris gallopavo SUMO1 antibody G1N7V8 92%
Dog SUMO1 antibody; Canis familiaris SUMO1 antibody E2RR10 100%
Duckbill platypus SUMO1 antibody; Ornithorhynchus anatinus SUMO1 antibody F7CFC3 92%
Goat SUMO1 antibody; Capra hircus SUMO1 antibody G1DGG7 92%
Gray short-tailed opossum SUMO1 antibody; Monodelphis domestica SUMO1 antibody F7ATG0 85%
Guinea pig SUMO1 antibody; Cavia porcellus SUMO1 antibody H0VKR6 100%
Horse LOC100067107 antibody; Equus caballus LOC100067107 antibody F6SYG5 100%
Human SUMO1 antibody; Homo sapiens SUMO1 antibody P63165 100%
Human SUMO1 antibody; Homo sapiens SUMO1 antibody B9A032 100%
Human SUMO1 antibody; Homo sapiens SUMO1 antibody B8ZZN6 100%
Human SUMO1 antibody; Homo sapiens SUMO1 antibody B8ZZJ0 100%
Little brown bat SUMO1 antibody; Myotis lucifugus SUMO1 antibody G1P9E0 100%
Lowland gorilla SUMO1 antibody; Gorilla gorilla gorilla SUMO1 antibody G3S6X5 100%
Mouse SUMO1 antibody; Mus musculus SUMO1 antibody P63166 100%
Mouse Sumo1 antibody; Mus musculus Sumo1 antibody Q8BT45 100%
Pig Ssc.7359 antibody; Sus scrofa Ssc.7359 antibody F1S3Z4 85%
Pig SUMO1 antibody; Sus scrofa SUMO1 antibody A7WLH8 100%
Pig SUMO1 antibody; Sus scrofa SUMO1 antibody B0M1N0 100%
Rabbit LOC100353123 antibody; Oryctolagus cuniculus LOC100353123 antibody G1TSW1 92%
Rabbit SUMO1 antibody; Oryctolagus cuniculus SUMO1 antibody G1TLU5 100%
Rat SUMO1 antibody; Rattus norvegicus SUMO1 antibody Q5I0H3 100%
Rhesus macaque LOC699185 antibody; Macaca mulatta LOC699185 antibody F7GXX7 100%
Rhesus macaque SUMO1 antibody; Macaca mulatta SUMO1 antibody F7BWQ2 100%
Sika deer SUMO1 antibody; Cervus nippon SUMO1 antibody Q9MZD5 100%
Small-eared galago SUMO1 antibody; Otolemur garnettii SUMO1 antibody H0XTR1 100%
Sumatran orangutan SUMO1 antibody; Pongo abelii SUMO1 antibody Q5R6J4 100%
Thirteen-lined ground squirrel SUMO1 antibody; Spermophilus tridecemlineatus SUMO1 antibody Q2EF74 100%
Western clawed frog SUMO1 antibody; Xenopus tropicalis SUMO1 antibody Q6DEP7 92%
White-tufted-ear marmoset LOC100402004 antibody; Callithrix jacchus LOC100402004 antibody F7HZB5 100%
White-tufted-ear marmoset LOC100402004 antibody; Callithrix jacchus LOC100402004 antibody F7HZB1 100%
White-tufted-ear marmoset LOC100402004 antibody; Callithrix jacchus LOC100402004 antibody F7ACJ2 100%
Zebra finch LOC100190232 antibody; Taeniopygia guttata LOC100190232 antibody B5FZ54 92%
Zebra finch Tgu.7947 antibody; Taeniopygia guttata Tgu.7947 antibody H0ZIP7 92%
 
X
Ask a Question