website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Sumo1 antibody - N-terminal region (ARP30639_P050)

Description of Target:
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development.
Gene Symbol:
Official Gene Full Name:
SMT3 suppressor of mif two 3 homolog 1 (yeast)
NCBI Gene Id:
Alias Symbols:
GMP1; MGC103203; PIC1; SENTRIN; SMT3; SMT3H3; SMTP3; SUMO-1; Smt3C; Ubl1
Tissue Tool:
Find tissues and cell lines supported to express Sumo1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Small ubiquitin-related modifier 1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Product Format:
Lyophilized powder
Complete computational species homology data:
Sumo1 antibody - N-terminal region (ARP30639_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%
Species Reactivity:
Pig, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Bovine, Goat
Datasheets / Downloads:
Printable datasheet for
anti-Sumo1 antibody
- ARP30639_P050
Peptide Sequence:
Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC
Blocking Peptide:
For anti-Sumo1 antibody is Catalog # AAP30639 (Previous Catalog # AAPP01292)
Key Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Sumo1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question