website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

Sumo1 antibody - N-terminal region (ARP30639_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Description of Target:
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development.
Gene Symbol:
Official Gene Full Name:
SMT3 suppressor of mif two 3 homolog 1 (yeast)
NCBI Gene Id:
Alias Symbols:
GMP1; MGC103203; PIC1; SENTRIN; SMT3; SMT3H3; SMTP3; SUMO-1; Smt3C; Ubl1
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Sumo1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Sumo1.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Small ubiquitin-related modifier 1
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
Pten; Stat1; Pml; Casp8ap2; Traf3; Pik3c3; Npm1; Mdm2; Ube2i; Trp53; Rangap1; Ranbp2; Mthfs; Sox2; Senp2; Rbbp7; Slc1a2; Uimc1; Nfatc2ip; Irf1; Irf8; Smad4; BCL11A; AXIN1; Myb; Pax6; Sept2; Daxx; Sf1; Sp3; Pou5f1; Hif1a; Nfkb2; Junb; Jun;
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-Sumo1 (ARP30639_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Species Reactivity:
Cow; Dog; Goat; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-Sumo1 (ARP30639_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC
Blocking Peptide:
For anti-Sumo1 (ARP30639_P050) antibody is Catalog # AAP30639 (Previous Catalog # AAPP01292)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Ask a Question