REV1 Antibody - C-terminal region (ARP73719_P050)

Catalog No: ARP73719_P050

Host: Rabbit
Target Name: REV1
Sample Type: Fetal Lung lysates
Antibody Dilution: 1.0ug/ml

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 83 and 80 kDa.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human REV1
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-REV1 (ARP73719_P050) antibody is Catalog # AAP73719
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

Target Info

• Gene Symbol: REV1
• Alias Symbols: REV1L, AIBP80
• NCBI Gene Id: 51455
• Description of Target: This gene encodes a protein with similarity to the S. cerevisiae mutagenesis protein Rev1. The Rev1 proteins contain a BRCT domain, which is important in protein-protein interactions. A suggested role for the human Rev1-like protein is as a scaffold that recruits DNA polymerases involved in translesion synthesis (TLS) of damaged DNA. Two alternatively spliced transcript variants that encode different proteins have been found.
• Uniprot ID: Q9UBZ9
• Protein Accession #: XP_005264024
• Protein Size (# AA): 1251
• Molecular Weight: 138 kDa
• Protein Interactions: RELA; POLD3; MSH2; REV3L; BRCA1; PCNA; MAD2L2; POLH; UBC; CDC27; REV1; POLK; POLI; C1orf86; MYC; HSP90AB1; HSP90AA1; POLDIP2; POLL; FHL2;