Catalog No: ARP61131_P050
Price: $0.00
SKU
ARP61131_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RAG2 (ARP61131_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: HLSAGSNKYYCNEHVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPA
Concentration0.5 mg/ml
Blocking PeptideFor anti-RAG2 (ARP61131_P050) antibody is Catalog # AAP61131
Gene SymbolRAG2
Gene Full NameRecombination activating gene 2
Alias SymbolsRAG-2
NCBI Gene Id5897
Protein NameV(D)J recombination-activating protein 2
Description of TargetThis gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4.
Uniprot IDP55895
Protein Accession #NP_000527
Nucleotide Accession #NM_000536
Protein Size (# AA)527
Molecular Weight59kDa
Protein InteractionsRAG1; VPRBP; DDB1; UBC; SKP2; IPO5; KPNA1; tax;
  1. What is the species homology for "RAG2 Antibody - C-terminal region (ARP61131_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "RAG2 Antibody - C-terminal region (ARP61131_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RAG2 Antibody - C-terminal region (ARP61131_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RAG2 Antibody - C-terminal region (ARP61131_P050)"?

    This target may also be called "RAG-2" in publications.

  5. What is the shipping cost for "RAG2 Antibody - C-terminal region (ARP61131_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RAG2 Antibody - C-terminal region (ARP61131_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RAG2 Antibody - C-terminal region (ARP61131_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "59kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RAG2 Antibody - C-terminal region (ARP61131_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RAG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RAG2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RAG2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RAG2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RAG2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RAG2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RAG2 Antibody - C-terminal region (ARP61131_P050)
Your Rating
We found other products you might like!