POLB Antibody - middle region (ARP56406_P050)

Catalog No: ARP56406_P050

WB Suggested Anti-POLB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate

Rabbit Anti-POLB Antibody
Catalog Number: ARP56406_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic, plasma membrane
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-POLB (ARP56406_P050) antibody is Catalog # AAP56406 (Previous Catalog # AAPP38719)
• Reference: Batra,V.K., (2008) Mol. Cell 30 (3), 315-324

Target Info

• Gene Symbol: POLB
• Gene Full Name: Polymerase (DNA directed), beta
• Alias Symbols: MGC125976
• NCBI Gene Id: 5423
• Protein Name: DNA polymerase beta
• Description of Target: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance. Also see POLA (MIM 312040).
• Uniprot ID: P06746
• Protein Accession #: NP_002681
• Nucleotide Accession #: NM_002690
• Protein Size (# AA): 335
• Molecular Weight: 38kDa
• Protein Interactions: TPP2; SRPK2; XRCC1; RAD27; HHV8GK18_gp81; UBC; UNG; STUB1; HUWE1; PARP1; PCNA; NCAPG; WRN; TAF1D; KAT7; RAD1; TLE1; PRKCA; APEX1; PNKP; NEIL1;