MSH5 Antibody - N-terminal region (ARP41358_P050)

Catalog No: ARP41358_P050

WB Suggested Anti-MSH5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateMSH5 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MSH5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MSH5 (ARP41358_P050) antibody is Catalog # AAP41358 (Previous Catalog # AAPS01605)
• Sample Type Confirmation:

  MSH5 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Target Info

• Gene Symbol: MSH5
• Gene Full Name: MutS homolog 5 (E. coli)
• Alias Symbols: G7, NG23, POF13, MUTSH5
• NCBI Gene Id: 4439
• Protein Name: G7 protein EMBL CAB52406.1
• Description of Target: MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4.This gene encodes a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4. Alternative splicing results in four transcript variants encoding three different isoforms.
• Uniprot ID: Q9UMP2
• Protein Accession #: NP_079535
• Nucleotide Accession #: NM_025259
• Protein Size (# AA): 851
• Molecular Weight: 95kDa
• Protein Interactions: MSH4; GPS2; UBC;