Mcm10 Antibody - N-terminal region (ARP36665_P050)

Catalog No: ARP36665_P050

WB Suggested Anti-Mcm10 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGDVEDLTDDEV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Mcm10 (ARP36665_P050) antibody is Catalog # AAP36665 (Previous Catalog # AAPP07922)

Target Info

• Gene Symbol: Mcm10
• Gene Full Name: Minichromosome maintenance deficient 10 (S. cerevisiae)
• Alias Symbols: C79164, AU018508, 2410041F14Rik, C330019M07Rik
• NCBI Gene Id: 70024
• Protein Name: Protein MCM10 homolog
• Description of Target: Mcm10 acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication. Additionally, plays a role in preventing DNA damage during replication.
• Uniprot ID: Q0VBD2
• Protein Accession #: NP_081566
• Nucleotide Accession #: NM_027290
• Protein Size (# AA): 885
• Molecular Weight: 98kDa
• Protein Interactions: Foxp3; Ndn;