- Description of Target:
- JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
- Gene Symbol:
- JUN
- Official Gene Full Name:
- Jun proto-oncogene
- Alias Symbols:
- AP-1; AP1; c-Jun
- Tissue Tool:
- Find tissues and cell lines supported to express JUN.

- Protein Accession# :
- NP_002219
- Nucleotide Accession#:
- NM_002228
- Swissprot Id:
- P05412
- Host:
- Rabbit
- Protein Size (# AA):
- 331
- Molecular Weight:
- 36kDa
- Application:
- WB
- Partner Proteins:
- KHSRP,BRCA1,BTG1,CYP19A1,ESR1,FBXW7,FBXW7,FBXW7,FOS,FOS,FOSL1,JAG1,JUN,JUN,JUN,JUNB,MAPK10,MAPK10,MAPK10,MAPK11,MAPK14,MAPK8,MAPK8,MAPK8,MAPK8,MAPK8,MAPK8,MAPK8,MAPK9,MAPK9,MAPK9,MAPK9,MAPK9,PLEKHO1,RB1,RELA,RFWD2,YWHAH,ABL1,AR,ATF1,ATF2,ATF3,ATF4,BATF,BCL3,BCL6,BRCA1,COBRA1,COPS5,CREB5,CREBBP,CSNK2A1,DDIT3,DDX21,DHX9,EGR1,ELF3,ELOF1,EN1,EP300,ERG,ESR1,ETS1,ETS2,FBXW7,FOS,FOSL1,FOSL2,GATA2,GTF2B,GTF2F2,HCFC1,HDAC3,HHEX,HIF1A,HMGA1,HNRNPM,HOXA9,HOXC8,IRAK1,ITCH,JDP2,JUN,MAF,MAFB,MAPK10,MAPK11,MAPK3,MAPK8,MAPK9,MAPKAPK5,MYBBP1A,MYOD1,NACA,NCOA1,NCOA2,NCOA3,NFE2L1,NFE2L2,NFYA,NR3C1,NR5A1,NRIP1,NTRK3,PACS1,PIAS1,PIN1,POU1F1,PRKD1,PRKDC,RAGE,RB1,RBM39,RELA,RFWD2,RPL18A,RUNX1,RUNX2,SKI,SMAD2,SMAD3,SMAD4,SMARCD1,SMARCD3,SNAPC5,SNRK,SOX10,SOX8,SP1,SPI1,SPIB,STAT1,STAT3,STAT4,SUMO1,SUMO2,SUMO3,SUMO4,TAF1,TBP,TCF20,TCF4,TDG,TGIF1,TOP1,TOP2A,TPM1,TPM2,TRIP4,TSC22D3,UBB,UBE2I,VDR,APLP2,AR,ARRB1,ASCC1,ASCC2,ASCC3,ATF2,ATF3,ATF4,BCL3,BCL6,BRCA1,CDKN1A,CEBPA,CHD3,COBRA1,COPS5,CREB5,CREBBP,CSK,CSNK2A1,CSNK2A2,DACH1,DDIT3,DDX21,DHX9,EDF1,EP300,ERG,ESR1,ETS1,ETS2,FOS,FOSL1,FOSL2,GATA2,GTF2B,GTF2E2,GTF2F1,GTF2F2,HDAC1,HDAC3,HDAC9,HIF1A,HMGA1,HNRNPM,HSP90AA1,ITCH,JDP2,JUN,KAT7,MACF1,MAPK1,MAPK3,MAPK8,MAPK9,MAZ,MBD3,MLL3,MTA3,MYC,MYOD1,NACA,NCOA1,NCOA6,NCOR2,NFE2L1,NFE2L2,NFYA,NR3C1,NR5A1,NRIP1,PHOX2A,PIAS1,PIAS2,PIN1,PML,POU1F1,PPP3CB,PPP4C,PRKD1,RB1,RBM39,RELA,RFWD2,RPS6KA2,RUNX1,RUNX2,SARS,SIRT1,SKI,SMAD2,SMAD3,SP1,SPI1,SPIB,STAT1,STAT3,STAT4,STAT6,SUMO1,SUMO2,SUMO3,Senp2,Smarca2,Smarcb1,TAF1,TBP,TCF20,TGIF1,TOP2A,TSC22D3,UBC,UBE2I,VAV1,VDR,tat
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- JUN antibody - middle region (ARP30926_P050)
- Predicted Homology Based on Immunogen Sequence:
- African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Sheep: 78%
- Datasheets / Downloads:
- Printable datasheet for
anti-JUN antibody
- ARP30926_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAAS
- Blocking Peptide:
- For anti-JUN antibody is Catalog # AAP30926
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-JUN antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Review:JUN antibody-middle region (ARP30926_P050) in sea urchin total embryonic lysate using Western blot
Product Page for JUN antibody-middle region (ARP30926_P050)
Researcher:Francesca Zito, PhD, Istituto di Biomedicina e Immunologia Molecolare Alberto Monroy
Application: Western blotting
Species+tissue/cell type:Lane1: 20ug sea urchin total embryonic lysate
Primary antibody dilution: 1:500
Secondary antibody: Goat anti-rabbit Alexa Fluor680
Secondary antibody dilution: 1:5000
| Questionnaire: | |
| How would you rate this antibody on a scale from 1-5 (5=best) and why? | Rate 4. The signal is clear and there is not background |
| Would you use this antibody in future experiments? | Yes, I will use it in future experiments |
| Have you used another antibody which has worked in your application? | Yes |
| Do you believe the information about the reagent on Aviva’s website is correct? | Yes |
| If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? | Yes, I am planning to use this antibody in future experiements since jun is involced in many signaling pathways and,if I can get good results, I want to publish them. |
| How did you store the antibody after re-suspension? | I stored an aliquot at 4 degree C for continous use and the remaining aliquots at -20 degree fpr long period storing. |
| Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): | 1: Sea urchin "Paracentrotus lividus"; total lysate of embryos; 3) 20 micrograms of total protein for each lane |
| How many different experimental trials were conducted using the antibody sample? | 3 |
| How was this sample prepared? | Embryos at the late gastrula stage were lysated in lysis buffer, composed of 20mM Tris, 2mM EDTA, 1% NP40, 15% Glycerol supplemented with antiproteases |
| Primary antibody dilution and incubation time: | Dilution 1:500, incubation time overnight at 4 degree C with gentle shaking |
| Secondary antibody used and dilution and incubation time: | Alexa Fluor680 goat anti-rabbit, dilution 1:5000, incubation 1h at room temperature with gentle shaking |
| Please include your detailed WB Procedure/Protocol here: | Proteins were seperated by 10 % SDS-PAGE minigel, transferred to nitrocellulose membrane using a semidry system. Western b lot was performed according to the manufacture's instructions (LI-COR Biosciences, Odyssey Infrared Imaging System). Briefly, the nitrocellulose membrane was incubated with Odyssey Blocking Buffer for 1h at RT. Primary antibody, diluted 1:500 in Odyssey Blocking Buffer +0.1% Tween-20, was incubated overnight at 4 degree C with gentle shaking. After washings with PBS + 0.1% Tween-20, the membrane was incubated with anti-rabbit Alexa Fluor680-labled secondary antibody, diluted 1:5000 in odyssey Blocking Buffer +0.1% Tween-20, for 1h at RT with gentle shaking. Proteins were detected by scanning using an Odyssey Detection system according to manufacturer's instructions. |
- Protocol:
- Tips Information:
See our General FAQ page.



