website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

JUN antibody - middle region (ARP30926_P050)

Description of Target:
JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Gene Symbol:
Official Gene Full Name:
Jun proto-oncogene
NCBI Gene Id:
Alias Symbols:
AP-1; AP1; c-Jun
Tissue Tool:
Find tissues and cell lines supported to express JUN.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Transcription factor AP-1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Product Format:
Lyophilized powder
Complete computational species homology data:
JUN antibody - middle region (ARP30926_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Sheep: 79%
Species Reactivity:
Dog, Horse, Rabbit, Rat, Guinea pig, Goat, Bovine, Human, Mouse, Zebrafish, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-JUN antibody
- ARP30926_P050
Peptide Sequence:
Synthetic peptide located within the following region: QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAAS
Blocking Peptide:
For anti-JUN antibody is Catalog # AAP30926
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-JUN antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for JUN antibody (ARP30926)

Product page for JUN antibody (ARP30926)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Acorn worm LOC100313553 antibody; Saccoglossus kowalevskii LOC100313553 antibody D1LWW3 85%
African clawed frog c-Jun antibody; Xenopus laevis c-Jun antibody Q9PVZ1 100%
African clawed frog c-Jun antibody; Xenopus laevis c-Jun antibody Q9PVZ0 100%
African clawed frog jun antibody; Xenopus laevis jun antibody Q8AVE4 100%
African clawed frog jun antibody; Xenopus laevis jun antibody Q6GLS7 100%
African clawed frog jund antibody; Xenopus laevis jund antibody Q68FJ3 78%
African elephant JUNB antibody; Loxodonta africana JUNB antibody G3TZP5 78%
African elephant LOC100670432 antibody; Loxodonta africana LOC100670432 antibody G3TME6 100%
American alligator c-jun antibody; Alligator mississippiensis c-jun antibody Q4W7I0 100%
Atlantic salmon JUN antibody; Salmo salar JUN antibody B5X2F5 100%
Atlantic salmon JUN antibody; Salmo salar JUN antibody C0HBL6 92%
Atlantic salmon JUN antibody; Salmo salar JUN antibody B5X2N9 92%
Atlantic salmon junb antibody; Salmo salar junb antibody B5X1C4 92%
Atlantic salmon JUND antibody; Salmo salar JUND antibody B5X4F7 84%
Atlantic salmon JUND antibody; Salmo salar JUND antibody B5X2B7 84%
Atlantic salmon JUND antibody; Salmo salar JUND antibody B9EP48 76%
Bighead carp c-jun antibody; Hypophthalmichthys nobilis c-jun antibody E7BR23 100%
Black carp c-jun antibody; Mylopharyngodon piceus c-jun antibody E7BR20 100%
Bovine JUN antibody; Bos taurus JUN antibody O77627 100%
Bovine JUN antibody; Bos taurus JUN antibody Q08DH1 100%
Bovine JUNB antibody; Bos taurus JUNB antibody Q0VBZ5 78%
Bovine JUND antibody; Bos taurus JUND antibody A7YY54 85%
Burton mouthbrooder c-jun antibody; Haplochromis burtoni c-jun antibody F5A3P3 100%
Chicken JUN antibody; Gallus gallus JUN antibody P18870 100%
Chicken JUN antibody; Gallus gallus JUN antibody F1NCN0 100%
Chicken JUN antibody; Gallus gallus JUN antibody E1C766 100%
Chicken JUND antibody; Gallus gallus JUND antibody P27921 85%
Chinese blunt snout bream c-jun antibody; Megalobrama amblycephala c-jun antibody E7BR25 100%
Chinese hook snout carp c-jun antibody; Opsariichthys bidens c-jun antibody E7BR29 100%
Common carp JUNB antibody; Cyprinus carpio JUNB antibody P79703 92%
Common turkey JUN antibody; Meleagris gallopavo JUN antibody G1NG75 100%
Culter alburnus c-jun antibody E7BR28 100%
Dog JUN antibody; Canis familiaris JUN antibody E2R6T4 100%
Dog JUNB antibody; Canis familiaris JUNB antibody E2RQI9 78%
Dog JUND antibody; Canis familiaris JUND antibody F1PKI6 85%
Duckbill platypus JUNB antibody; Ornithorhynchus anatinus JUNB antibody F7CQ21 78%
Duckbill platypus JUND antibody; Ornithorhynchus anatinus JUND antibody F6T6T3 85%
Elopichthys bambusa c-jun antibody E7BR26 100%
Fruit fly DanaGF12018 antibody; Drosophila ananassae DanaGF12018 antibody B3MD12 78%
Fruit fly DereGG24138 antibody; Drosophila erecta DereGG24138 antibody B3N6I6 78%
Fruit fly DperGL17608 antibody; Drosophila persimilis DperGL17608 antibody B4GHX0 78%
Fruit fly DpseGA15338 antibody; Drosophila pseudoobscura pseudoobscura DpseGA15338 antibody Q28ZD6 78%
Fruit fly DsecGM21184 antibody; Drosophila sechellia DsecGM21184 antibody B4HMD0 78%
Fruit fly DsimGD15385 antibody; Drosophila simulans DsimGD15385 antibody B4NSC3 78%
Fruit fly DwilGK21594 antibody; Drosophila willistoni DwilGK21594 antibody B4MPI6 78%
Fruit fly DyakGE19337 antibody; Drosophila yakuba DyakGE19337 antibody B4NX50 78%
Fruit fly JRA antibody; Drosophila melanogaster JRA antibody P18289 78%
Giant panda LOC100483834 antibody; Ailuropoda melanoleuca LOC100483834 antibody G1L085 100%
Goldfish c-jun antibody; Carassius auratus c-jun antibody Q7T3K3 100%
Grass carp c-jun antibody; Ctenopharyngodon idella c-jun antibody E7BR21 100%
Gray short-tailed opossum JUND antibody; Monodelphis domestica JUND antibody F7DX00 85%
Gray short-tailed opossum JUND antibody; Monodelphis domestica JUND antibody F7BG71 85%
Gray short-tailed opossum LOC100009986 antibody; Monodelphis domestica LOC100009986 antibody F7AHF4 78%
Gray short-tailed opossum LOC100018774 antibody; Monodelphis domestica LOC100018774 antibody F7DYE9 100%
Green anole LOC100567718 antibody; Anolis carolinensis LOC100567718 antibody G1KG27 100%
Guinea pig JUN antibody; Cavia porcellus JUN antibody H0WDS1 100%
Guinea pig JUNB antibody; Cavia porcellus JUNB antibody H0VUV8 78%
Guinea pig JUND antibody; Cavia porcellus JUND antibody H0VU87 85%
Horse LOC100067469 antibody; Equus caballus LOC100067469 antibody F6YYG4 100%
Horse LOC100146801 antibody; Equus caballus LOC100146801 antibody F6Y5A4 78%
Human JUN antibody; Homo sapiens JUN antibody P05412 100%
Human JUN antibody; Homo sapiens JUN antibody Q6FHM7 100%
Human JUN antibody; Homo sapiens JUN antibody Q6FHK0 100%
Human JUNB antibody; Homo sapiens JUNB antibody P17275 78%
Human JUNB antibody; Homo sapiens JUNB antibody Q5U079 78%
Human JUNB antibody; Homo sapiens JUNB antibody Q53HP8 78%
Human JUND antibody; Homo sapiens JUND antibody P17535 85%
Island canary JUN antibody; Serinus canaria JUN antibody P54864 100%
Japanese pufferfish c-Jun antibody; Takifugu rubripes c-Jun antibody Q800B5 100%
Japanese pufferfish c-JunL antibody; Takifugu rubripes c-JunL antibody Q800B4 92%
Japanese pufferfish fjun antibody; Takifugu rubripes fjun antibody Q800B2 84%
Japanese pufferfish junB antibody; Takifugu rubripes junB antibody Q800B3 92%
Japanese pufferfish junDLb antibody; Takifugu rubripes junDLb antibody Q800B0 85%
Japanese quail JUN antibody; Coturnix coturnix japonica JUN antibody P12981 100%
Little brown bat JUN antibody; Myotis lucifugus JUN antibody G1Q234 92%
Little brown bat JUNB antibody; Myotis lucifugus JUNB antibody G1QAD8 78%
Lowland gorilla JUN antibody; Gorilla gorilla gorilla JUN antibody G3SFX7 100%
Lowland gorilla JUN antibody; Gorilla gorilla gorilla JUN antibody G3QL30 100%
Lowland gorilla JUND antibody; Gorilla gorilla gorilla JUND antibody G3S843 85%
Mouse JUN antibody; Mus musculus JUN antibody P05627 100%
Mouse Jun antibody; Mus musculus Jun antibody Q52L79 100%
Mouse Jun antibody; Mus musculus Jun antibody Q3V255 100%
Mouse Jun antibody; Mus musculus Jun antibody Q3US19 100%
Mouse JUNB antibody; Mus musculus JUNB antibody P09450 78%
Mouse Junb antibody; Mus musculus Junb antibody Q569U6 78%
Mouse Junb antibody; Mus musculus Junb antibody Q3U2Y0 78%
Mouse Junb antibody; Mus musculus Junb antibody Q3TXR4 78%
Mouse JUND antibody; Mus musculus JUND antibody P15066 85%
Mouse Jund antibody; Mus musculus Jund antibody Q52L49 85%
Nile crocodile c-jun antibody; Crocodylus niloticus c-jun antibody Q4W7H8 100%
Northern white-cheeked gibbon COMP antibody; Nomascus leucogenys COMP antibody G1R209 85%
Northern white-cheeked gibbon JUN antibody; Nomascus leucogenys JUN antibody 100%
Ochetobius elongatus c-jun antibody E7BR30 100%
Pig JUN antibody; Sus scrofa JUN antibody P56432 100%
Pig JUN antibody; Sus scrofa JUN antibody F1S7A7 100%
Pseudemys nelsoni c-jun antibody Q4W7H9 100%
Rabbit JUN antibody; Oryctolagus cuniculus JUN antibody G1TVU3 100%
Rainbow trout jun antibody; Oncorhynchus mykiss jun antibody Q2L4Q5 92%
Rainbow trout LOC100136256 antibody; Oncorhynchus mykiss LOC100136256 antibody Q1M162 92%
Rat JUN antibody; Rattus norvegicus JUN antibody P17325 100%
Rat JUNB antibody; Rattus norvegicus JUNB antibody P24898 78%
Rat JUND antibody; Rattus norvegicus JUND antibody P52909 85%
Red flour beetle Jra antibody; Tribolium castaneum Jra antibody D6WV99 78%
Rhesus macaque JUN antibody; Macaca mulatta JUN antibody F7A6Z1 100%
Rhesus macaque JUNB antibody; Macaca mulatta JUNB antibody F6U5C5 78%
Sheep junB antibody; Ovis aries junB antibody Q9MZ10 78%
Silver carp c-jun antibody; Hypophthalmichthys molitrix c-jun antibody E7BR22 100%
Small-eared galago JUN antibody; Otolemur garnettii JUN antibody H0XMF1 100%
Small-eared galago JUNB antibody; Otolemur garnettii JUNB antibody H0XSX7 78%
Small-eared galago JUND antibody; Otolemur garnettii JUND antibody H0XT88 85%
Southern platyfish JunA antibody; Xiphophorus maculatus JunA antibody Q2V8U8 92%
Squaliobarbus curriculus c-jun antibody E7BR24 100%
strain 17 JUN antibody; Avian sarcoma virus JUN antibody P05411 100%
Synthetic construct JUND antibody B6ID81 85%
Three-spined stickleback JUN (1 of 2) antibody; Gasterosteus aculeatus JUN (1 of 2) antibody G3PV32 85%
Three-spined stickleback JUN (2 of 2) antibody; Gasterosteus aculeatus JUN (2 of 2) antibody G3PNU7 85%
Three-spined stickleback JUNB (1 of 2) antibody; Gasterosteus aculeatus JUNB (1 of 2) antibody G3NTZ1 78%
Three-spined stickleback JUND antibody; Gasterosteus aculeatus JUND antibody G3PS75 84%
Western clawed frog junb antibody; Xenopus tropicalis junb antibody Q28IY7 78%
Western clawed frog junb antibody; Xenopus tropicalis junb antibody F6VBM6 78%
Western clawed frog jund antibody; Xenopus tropicalis jund antibody F6ZCE6 85%
Western clawed frog jund.2 antibody; Xenopus tropicalis jund.2 antibody F6Z1A9 85%
Western clawed frog LOC100493911 antibody; Xenopus tropicalis LOC100493911 antibody F6RYL1 100%
yellowfin c-jun antibody; Xenocypris argentea c-jun antibody E7BR27 100%
Zebra finch LOC100225683 antibody; Taeniopygia guttata LOC100225683 antibody H0YPP1 85%
Zebra finch LOC100229914 antibody; Taeniopygia guttata LOC100229914 antibody H0ZHC6 100%
Zebrafish jun antibody; Danio rerio jun antibody Q6NZT5 100%
Zebrafish jun antibody; Danio rerio jun antibody Q4ZJE9 100%
Zebrafish junb antibody; Danio rerio junb antibody C5IG46 92%
Zebrafish junba antibody; Danio rerio junba antibody Q7T367 92%
Zebrafish junbb antibody; Danio rerio junbb antibody Q7T3E3 92%
Zebrafish jund antibody; Danio rerio jund antibody B0V1Q6 84%
Zebrafish zgc:153924 antibody; Danio rerio zgc:153924 antibody Q08BZ3 84%

Product Review:JUN antibody-middle region (ARP30926_P050) in sea urchin total embryonic lysate using Western blot

Product Page for JUN antibody-middle region (ARP30926_P050)

Researcher:Francesca Zito, PhD, Istituto di Biomedicina e Immunologia Molecolare Alberto Monroy
Application: Western blotting
Species+tissue/cell type:Lane1: 20ug sea urchin total embryonic lysate
Primary antibody dilution: 1:500
Secondary antibody: Goat anti-rabbit Alexa Fluor680
Secondary antibody dilution: 1:5000

How would you rate this antibody on a scale from 1-5 (5=best) and why? Rate 4. The signal is clear and there is not background
Would you use this antibody in future experiments? Yes, I will use it in future experiments
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva’s website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, I am planning to use this antibody in future experiements since jun is involced in many signaling pathways and,if I can get good results, I want to publish them.
How did you store the antibody after re-suspension? I stored an aliquot at 4 degree C for continous use and the remaining aliquots at -20 degree fpr long period storing.
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): 1: Sea urchin "Paracentrotus lividus"; total lysate of embryos; 3) 20 micrograms of total protein for each lane
How many different experimental trials were conducted using the antibody sample? 3
How was this sample prepared? Embryos at the late gastrula stage were lysated in lysis buffer, composed of 20mM Tris, 2mM EDTA, 1% NP40, 15% Glycerol supplemented with antiproteases
Primary antibody dilution and incubation time: Dilution 1:500, incubation time overnight at 4 degree C with gentle shaking
Secondary antibody used and dilution and incubation time: Alexa Fluor680 goat anti-rabbit, dilution 1:5000, incubation 1h at room temperature with gentle shaking
Please include your detailed WB Procedure/Protocol here: Proteins were seperated by 10 % SDS-PAGE minigel, transferred to nitrocellulose membrane using a semidry system. Western b lot was performed according to the manufacture's instructions (LI-COR Biosciences, Odyssey Infrared Imaging System). Briefly, the nitrocellulose membrane was incubated with Odyssey Blocking Buffer for 1h at RT. Primary antibody, diluted 1:500 in Odyssey Blocking Buffer +0.1% Tween-20, was incubated overnight at 4 degree C with gentle shaking. After washings with PBS + 0.1% Tween-20, the membrane was incubated with anti-rabbit Alexa Fluor680-labled secondary antibody, diluted 1:5000 in odyssey Blocking Buffer +0.1% Tween-20, for 1h at RT with gentle shaking. Proteins were detected by scanning using an Odyssey Detection system according to manufacturer's instructions.
Ask a Question