website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

JUN antibody - middle region (ARP30926_P050)

  • Catalog#: ARP30926_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Jun proto-oncogene
    Protein Name:
    Transcription factor AP-1
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    AP-1, AP1, c-Jun
    Description of Target:
    JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express JUN.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express JUN.
    Species Reactivity:
    Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 100%
    Complete computational species homology data:
    Anti-JUN (ARP30926_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAAS
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-JUN (ARP30926_P050) antibody is Catalog # AAP30926
    Datasheets / Downloads:
    Printable datasheet for anti-JUN (ARP30926_P050) antibody

    Product Review:JUN antibody-middle region (ARP30926_P050) in sea urchin total embryonic lysate using Western blot

    Product Page for JUN antibody-middle region (ARP30926_P050)

    Researcher:Francesca Zito, PhD, Istituto di Biomedicina e Immunologia Molecolare Alberto Monroy
    Application: Western blotting
    Species+tissue/cell type:Lane1: 20ug sea urchin total embryonic lysate
    Primary antibody dilution: 1:500
    Secondary antibody: Goat anti-rabbit Alexa Fluor680
    Secondary antibody dilution: 1:5000

    How would you rate this antibody on a scale from 1-5 (5=best) and why?Rate 4. The signal is clear and there is not background
    Would you use this antibody in future experiments?Yes, I will use it in future experiments
    Have you used another antibody which has worked in your application?Yes
    Do you believe the information about the reagent on Aviva’s website is correct?Yes
    If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?Yes, I am planning to use this antibody in future experiements since jun is involced in many signaling pathways and,if I can get good results, I want to publish them.
    How did you store the antibody after re-suspension?I stored an aliquot at 4 degree C for continous use and the remaining aliquots at -20 degree fpr long period storing.
    Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):1: Sea urchin "Paracentrotus lividus"; total lysate of embryos; 3) 20 micrograms of total protein for each lane
    How many different experimental trials were conducted using the antibody sample?3
    How was this sample prepared?Embryos at the late gastrula stage were lysated in lysis buffer, composed of 20mM Tris, 2mM EDTA, 1% NP40, 15% Glycerol supplemented with antiproteases
    Primary antibody dilution and incubation time:Dilution 1:500, incubation time overnight at 4 degree C with gentle shaking
    Secondary antibody used and dilution and incubation time:Alexa Fluor680 goat anti-rabbit, dilution 1:5000, incubation 1h at room temperature with gentle shaking
    Please include your detailed WB Procedure/Protocol here:Proteins were seperated by 10 % SDS-PAGE minigel, transferred to nitrocellulose membrane using a semidry system. Western b lot was performed according to the manufacture's instructions (LI-COR Biosciences, Odyssey Infrared Imaging System). Briefly, the nitrocellulose membrane was incubated with Odyssey Blocking Buffer for 1h at RT. Primary antibody, diluted 1:500 in Odyssey Blocking Buffer +0.1% Tween-20, was incubated overnight at 4 degree C with gentle shaking. After washings with PBS + 0.1% Tween-20, the membrane was incubated with anti-rabbit Alexa Fluor680-labled secondary antibody, diluted 1:5000 in odyssey Blocking Buffer +0.1% Tween-20, for 1h at RT with gentle shaking. Proteins were detected by scanning using an Odyssey Detection system according to manufacturer's instructions.
    Ask a Question