website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

JUN antibody - middle region (ARP30926_P050)

Description of Target:
JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
Gene Symbol:
JUN
Official Gene Full Name:
Jun proto-oncogene
NCBI Gene Id:
3725
Alias Symbols:
AP-1; AP1; c-Jun
Tissue Tool:
Find tissues and cell lines supported to express JUN.
Protein Accession #:
NP_002219
Nucleotide Accession#:
NM_002228
Swissprot Id:
P05412
Host:
Rabbit
Protein Name:
Transcription factor AP-1
Protein Size (# AA):
331
Molecular Weight:
36kDa
Application:
WB
Partner Proteins:
KHSRP,BRCA1,BTG1,CYP19A1,ESR1,FBXW7,FBXW7,FBXW7,FOS,FOS,FOSL1,JAG1,JUN,JUN,JUN,JUNB,MAPK10,MAPK10,MAPK10,MAPK11,MAPK14,MAPK8,MAPK8,MAPK8,MAPK8,MAPK8,MAPK8,MAPK8,MAPK9,MAPK9,MAPK9,MAPK9,MAPK9,PLEKHO1,RB1,RELA,RFWD2,YWHAH,ABL1,AR,ATF1,ATF2,ATF3,ATF4,BATF,BCL3,BCL6,BRCA1,COBRA1,COPS5,CREB5,CREBBP,CSNK2A1,DDIT3,DDX21,DHX9,EGR1,ELF3,ELOF1,EN1,EP300,ERG,ESR1,ETS1,ETS2,FBXW7,FOS,FOSL1,FOSL2,GATA2,GTF2B,GTF2F2,HCFC1,HDAC3,HHEX,HIF1A,HMGA1,HNRNPM,HOXA9,HOXC8,IRAK1,ITCH,JDP2,JUN,MAF,MAFB,MAPK10,MAPK11,MAPK3,MAPK8,MAPK9,MAPKAPK5,MYBBP1A,MYOD1,NACA,NCOA1,NCOA2,NCOA3,NFE2L1,NFE2L2,NFYA,NR3C1,NR5A1,NRIP1,NTRK3,PACS1,PIAS1,PIN1,POU1F1,PRKD1,PRKDC,RAGE,RB1,RBM39,RELA,RFWD2,RPL18A,RUNX1,RUNX2,SKI,SMAD2,SMAD3,SMAD4,SMARCD1,SMARCD3,SNAPC5,SNRK,SOX10,SOX8,SP1,SPI1,SPIB,STAT1,STAT3,STAT4,SUMO1,SUMO2,SUMO3,SUMO4,TAF1,TBP,TCF20,TCF4,TDG,TGIF1,TOP1,TOP2A,TPM1,TPM2,TRIP4,TSC22D3,UBB,UBE2I,VDR,APLP2,AR,ARRB1,ASCC1,ASCC2,ASCC3,ATF2,ATF3,ATF4,BCL3,BCL6,BRCA1,CDKN1A,CEBPA,CHD3,COBRA1,COPS5,CREB5,CREBBP,CSK,CSNK2A1,CSNK2A2,DACH1,DDIT3,DDX21,DHX9,EDF1,EP300,ERG,ESR1,ETS1,ETS2,FOS,FOSL1,FOSL2,GATA2,GTF2B,GTF2E2,GTF2F1,GTF2F2,HDAC1,HDAC3,HDAC9,HIF1A,HMGA1,HNRNPM,HSP90AA1,ITCH,JDP2,JUN,KAT7,MACF1,MAPK1,MAPK3,MAPK8,MAPK9,MAZ,MBD3,MLL3,MTA3,MYC,MYOD1,NACA,NCOA1,NCOA6,NCOR2,NFE2L1,NFE2L2,NFYA,NR3C1,NR5A1,NRIP1,PHOX2A,PIAS1,PIAS2,PIN1,PML,POU1F1,PPP3CB,PPP4C,PRKD1,RB1,RBM39,RELA,RFWD2,RPS6KA2,RUNX1,RUNX2,SARS,SIRT1,SKI,SMAD2,SMAD3,SP1,SPI1,SPIB,STAT1,STAT3,STAT4,STAT6,SUMO1,SUMO2,SUMO3,Senp2,Smarca2,Smarcb1,TAF1,TBP,TCF20,TGIF1,TOP2A,TSC22D3,UBC,UBE2I,VAV1,VDR,tat
Product Format:
Lyophilized powder
Complete computational species homology data:
JUN antibody - middle region (ARP30926_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Sheep: 79%
Species Reactivity:
Dog, Horse, Rabbit, Rat, Guinea pig, Goat, Bovine, Human, Mouse, Zebrafish, Sheep
Datasheets / Downloads:
Printable datasheet for
anti-JUN antibody
- ARP30926_P050
Peptide Sequence:
Synthetic peptide located within the following region: QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAAS
Blocking Peptide:
For anti-JUN antibody is Catalog # AAP30926
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-JUN antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question