HUS1B Antibody - N-terminal region (ARP52871_P050)

Catalog No: ARP52871_P050

WB Suggested Anti-HUS1B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HUS1B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HUS1B (ARP52871_P050) antibody is Catalog # AAP52871 (Previous Catalog # AAPS30905)
• Reference: Dufault,V.M., (2003) Genomics 82 (6), 644-651

Target Info

• Gene Symbol: HUS1B
• Gene Full Name: HUS1 checkpoint homolog b (S. pombe)
• Alias Symbols: MGC126746, MGC126748, RP11-532F6.1
• NCBI Gene Id: 135458
• Protein Name: Checkpoint protein HUS1B
• Description of Target: HUS1Bis most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. HUS1B can interact with the check point protein RAD1 but not with RAD9. Overexpression of HUS1B has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.The protein encoded by this gene is most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. This protein can interact with the check point protein RAD1 but not with RAD9. Overexpression of this protein has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.
• Uniprot ID: Q8NHY5
• Protein Accession #: NP_683762
• Nucleotide Accession #: NM_148959
• Protein Size (# AA): 278
• Molecular Weight: 31kDa
• Protein Interactions: RAD9B; RAD9A; HUS1; RAD1;