HTATIP antibody - N-terminal region (ARP32488_P050)

Catalog#: ARP32488_P050

• Size: 50ug

Human THP-1

• Description of Target: HTATIP belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants. The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants.
• Gene Symbol: HTATIP
• Official Gene Full Name: K(lysine) acetyltransferase 5
• Alias Symbols: ESA1; HTATIP1; KAT5; PLIP; TIP; TIP60; cPLA2; HTATIP
• Protein Accession#: NP_874369
• Nucleotide Accession#: NM_182710
• Swissprot Id: C9JL99
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 546
• Molecular Weight: 62kDa
• Application: WB
• Partner Proteins: RB1, E2F1, E2F2, E2F4, RBL2, E2F4, BEGAIN, BRF1, CCNA1, CCNA2, CCND1, CCNE1, CDK2, CDK4, CEBPA, CREG1, DGKZ, DHX30, E2F4, E2F5, HDAC1, ID2, KDM5A, MCM7, MYBL2, MYC, NR2E3, PHB, PPP2R3A, RBBP8, RBBP9, RBL1, SMAD2, SMAD3, SMAD4, SNW1, SP1, SUV39H1, SUV420H2, TAF1, USP4, AATF, ARID4A, BEGAIN, BRCA1, BR
• Immunogen: The immunogen for anti-HTATIP antibody: synthetic peptide directed towards the N terminal of human HTATIP
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: EAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKERE
• Blocking Peptide: For anti-HTATIP antibody is Catalog # AAP32488 (Previous Catalog # AAPP03487)
• Key Reference: Hejna,J., (2008) J. Biol. Chem. 283 (15), 9844-9851
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-HTATIP antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: HTATIP antibody tested with Human Thp-1 Cells (ARP32488_P050)

Aviva Systems Biology is the original manufacturer of this HTATIP antibody (ARP32488_P050)

Click here to view the HTATIP antibody Western Blot Protocol

Product Datasheet Link: HTATIP antibody (ARP32488_P050)

WB Suggested Anti-HTATIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1

Western Blot image:


Description of Target: HTATIP belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants. The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s HTATIP antibody (ARP32488_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com