SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48852_P050
Price: $0.00
SKU
ARP48852_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-UGGT2 (ARP48852_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human UGCGL2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 91%; Human: 100%; Mouse: 91%; Pig: 91%; Rabbit: 82%; Rat: 100%; Yeast: 90%
Peptide SequenceSynthetic peptide located within the following region: LCNNPKTKESKLKAAARIVPEWVEYDAEIRQLLDHLENKKQDTILTHDEL
Concentration0.5 mg/ml
Blocking PeptideFor anti-UGGT2 (ARP48852_P050) antibody is Catalog # AAP48852 (Previous Catalog # AAPP28905)
Sample Type Confirmation

UGGT2 is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceArnold,S.M. (2003) J. Biol. Chem. 278 (44), 43320-43328
Gene SymbolUGGT2
Gene Full NameUDP-glucose glycoprotein glucosyltransferase 2
Alias SymbolsUGT2, HUGT2, UGCGL2
NCBI Gene Id55757
Protein NameUDP-glucose:glycoprotein glucosyltransferase 2
Description of TargetUGCGL2 recognizes glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.
Uniprot IDQ9NYU1
Protein Accession #NP_064506
Nucleotide Accession #NM_020121
Protein Size (# AA)1516
Molecular Weight172kDa
Protein InteractionsAPPBP2; FBXO6; METTL23; OS9; APP; BABAM1; BRE; SEP15;
  1. What is the species homology for "UGCGL2 Antibody - middle region (ARP48852_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast".

  2. How long will it take to receive "UGCGL2 Antibody - middle region (ARP48852_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UGCGL2 Antibody - middle region (ARP48852_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UGCGL2 Antibody - middle region (ARP48852_P050)"?

    This target may also be called "UGT2, HUGT2, UGCGL2" in publications.

  5. What is the shipping cost for "UGCGL2 Antibody - middle region (ARP48852_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UGCGL2 Antibody - middle region (ARP48852_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UGCGL2 Antibody - middle region (ARP48852_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "172kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UGCGL2 Antibody - middle region (ARP48852_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "UGGT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UGGT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UGGT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UGGT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UGGT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UGGT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UGCGL2 Antibody - middle region (ARP48852_P050)
Your Rating
We found other products you might like!