Trim35 Antibody - middle region (ARP34444_P050)

Catalog No: ARP34444_P050

Host: Rabbit
Target Name: Trim35
Sample Type: Mouse Kidney lysates
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: TRIM35
Sample Tissue: Mouse Mouse Spleen
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of MOUSE Trim35
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Trim35 (ARP34444_P050) antibody is Catalog # AAP34444

Target Info

• Gene Symbol: Trim35
• Alias Symbols: M, Hl, NC8, HLS5, Mair, AW046487, mKIAA1098, 0710005M05Rik, A430106H13Rik
• NCBI Gene Id: 66854
• Description of Target: Trim35 may play a role as a tumor suppressor. It implicated in the cell death mechanism.
• Uniprot ID: Q8C006
• Protein Accession #: NP_084255
• Nucleotide Accession #: NM_029979
• Protein Size (# AA): 501
• Molecular Weight: 55kDa
• Protein Interactions: Mtf2; Jarid2; Ezh2; Eed; SMURF1; SMAD4; SMAD3; SMAD2;