Catalog No: ARP65151_P050
Price: $0.00
SKU
ARP65151_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TNK1 (ARP65151_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Guinea Pig, Pig, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 83%; Human: 100%; Pig: 85%; Rabbit: 77%; Yeast: 100%
Peptide SequenceSynthetic peptide located within the following region: EIRQARAVPQGPPGLPPRPPLSSSSPQPSQPSRERLPWPKRKPPHNHPMG
Concentration0.5 mg/ml
Blocking PeptideFor anti-TNK1 (ARP65151_P050) antibody is Catalog # AAP65151
Sample Type Confirmation

TNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Gene SymbolTNK1
Gene Full NameTyrosine kinase, non-receptor, 1
Alias SymbolsKOS1
NCBI Gene Id8711
Protein NameNon-receptor tyrosine-protein kinase TNK1
Description of TargetThe protein encoded by this gene belongs to the tyrosine protein kinase family. Tyrosine protein kinases are important regulators of intracellular signal transduction pathways, mediating cellular proliferation, survival, and development. This gene is highly expressed in fetal tissues and at lower levels in few adult tissues, thus may function in signaling pathways utilized broadly during fetal development, and more selectively in adult tissues. It plays a negative regulatory role in the Ras-Raf1-MAPK pathway, and knockout mice have been shown to develop spontaneous tumors, suggesting a role as a tumor suppressor gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ13470
Protein Accession #NP_003976
Nucleotide Accession #NM_003985
Protein Size (# AA)661
Molecular Weight72kDa
Protein InteractionsHSP90AA1; UBC; PLCG1; TNK1; SFN;
  1. What is the species homology for "TNK1 Antibody - C-terminal region (ARP65151_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Guinea Pig, Pig, Rabbit, Yeast".

  2. How long will it take to receive "TNK1 Antibody - C-terminal region (ARP65151_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TNK1 Antibody - C-terminal region (ARP65151_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TNK1 Antibody - C-terminal region (ARP65151_P050)"?

    This target may also be called "KOS1" in publications.

  5. What is the shipping cost for "TNK1 Antibody - C-terminal region (ARP65151_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TNK1 Antibody - C-terminal region (ARP65151_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TNK1 Antibody - C-terminal region (ARP65151_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "72kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TNK1 Antibody - C-terminal region (ARP65151_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TNK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TNK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TNK1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TNK1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TNK1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TNK1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TNK1 Antibody - C-terminal region (ARP65151_P050)
Your Rating
We found other products you might like!