PMP22 Antibody - N-terminal region (ARP63220_P050)

Catalog No: ARP63220_P050

WB Suggested Anti-PMP22 Antibody
Titration: 1.0 ug/ml
Positive Control: 721_B Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of PMP22
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Rabbit: 100%; Rat: 93%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: QWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFS
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: PMP22
• Alias Symbols: DSS, CIDP, GAS3, HNPP, CMT1A, CMT1E, GAS-3, Sp110, HMSNIA
• NCBI Gene Id: 5376
• Protein Name: Peripheral myelin protein 22
• Description of Target: This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing of this gene results in three transcript variants that encode the same protein.
• Uniprot ID: Q01453
• Protein Accession #: NP_696996
• Nucleotide Accession #: NM_153321
• Protein Size (# AA): 160
• Molecular Weight: 18kDa
• Protein Interactions: SMIM3; KLRC1; PEX19; DDX52; ELAVL1; MPZ; CANX;