MVB12B Antibody - C-terminal region (ARP70312_P050)

Catalog No: ARP70312_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: MVB12B
Sample Tissue: Human MDA-MB-435S Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MVB12B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: HISLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPES
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MVB12B (ARP70312_P050) antibody is Catalog # AAP70312
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that MVB12B is expressed in MDA-MB435

• Subunit: 12B

Target Info

• Gene Symbol: MVB12B
• Alias Symbols: C9orf28, FAM125B
• NCBI Gene Id: 89853
• Protein Name: Multivesicular body subunit 12B
• Description of Target: The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9H7P6
• Protein Accession #: NP_258257
• Nucleotide Accession #: NM_033446
• Protein Size (# AA): 319
• Molecular Weight: 35kDa
• Protein Interactions: LNX1; gag; UBC; VPS37A; MVB12A; TSG101;