MLNR Antibody - C-terminal region (ARP65344_P050)

Catalog No: ARP65344_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-MLNR Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MLNR
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MLNR (ARP65344_P050) antibody is Catalog # AAP65344

Target Info

• Gene Symbol: MLNR
• Alias Symbols: GPR38, MTLR1
• NCBI Gene Id: 2862
• Protein Name: Motilin receptor
• Description of Target: Motilin is a 22 amino acid peptide hormone expressed throughout the gastrointestinal (GI) tract. The protein encoded by this gene is a motilin receptor which is a member of the G-protein coupled receptor 1 family. This member is a multi-pass transmembrane protein, and is an important therapeutic target for the treatment of hypomotility disorders.
• Uniprot ID: O43193
• Protein Accession #: NP_001498
• Nucleotide Accession #: NM_001507
• Protein Size (# AA): 412
• Molecular Weight: 45kDa
• Protein Interactions: MLN; GHRL; GPRASP1; GHRHR;