SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63482_P050
Price: $0.00
SKU
ARP63482_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MCAM (ARP63482_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human MCAM
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Guinea Pig: 77%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 79%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: STSTASPHTRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFL
Concentration0.5 mg/ml
Blocking PeptideFor anti-MCAM (ARP63482_P050) antibody is Catalog # AAP63482
Sample Type Confirmation

There is BioGPS gene expression data showing that MCAM is expressed in HepG2

Gene SymbolMCAM
Gene Full Namemelanoma cell adhesion molecule
Alias SymbolsCD146, MUC18, HEMCAM, METCAM, MelCAM
NCBI Gene Id4162
Protein NameCell surface glycoprotein MUC18
Description of TargetMCAM plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. MCAM could be an adhesion molecule active in neural crest cells during embryonic development. MCAM acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2, and a transient increase in the intracellular calcium concentration.
Uniprot IDP43121-2
Protein Size (# AA)527
Molecular Weight57kDa
Protein InteractionsADRB2; UBC; HSP90AA5P; HSPA1L; ATF7IP; PTK2B; FYN;
  1. What is the species homology for "MCAM Antibody - C-terminal region (ARP63482_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "MCAM Antibody - C-terminal region (ARP63482_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MCAM Antibody - C-terminal region (ARP63482_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MCAM Antibody - C-terminal region (ARP63482_P050)"?

    This target may also be called "CD146, MUC18, HEMCAM, METCAM, MelCAM" in publications.

  5. What is the shipping cost for "MCAM Antibody - C-terminal region (ARP63482_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MCAM Antibody - C-terminal region (ARP63482_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MCAM Antibody - C-terminal region (ARP63482_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MCAM Antibody - C-terminal region (ARP63482_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MCAM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MCAM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MCAM"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MCAM"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MCAM"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MCAM"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MCAM Antibody - C-terminal region (ARP63482_P050)
Your Rating
We found other products you might like!