website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/7/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

LIPG antibody - middle region (ARP30655_P050)

Receive a free positive control (AHL009) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Lipase, endothelial
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LIPG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LIPG.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Endothelial lipase
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the middle region of human LIPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-LIPG (ARP30655_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 77%; Rabbit: 100%; Rat: 82%; Sheep: 100%
Species Reactivity:
Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat; Sheep
Datasheets / Downloads:
Printable datasheet for anti-LIPG (ARP30655_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP
Blocking Peptide:
For anti-LIPG (ARP30655_P050) antibody is Catalog # AAP30655 (Previous Catalog # AAPP01312)
Additional Information:
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Willer,C.J., (2008) Nat. Genet. 40 (2), 161-169
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: LIPG antibody tested with Human Mcf7 Cells (ARP30655_P050)

Aviva Systems Biology is the original manufacturer of this LIPG antibody (ARP30655_P050)

Click here to view the LIPG antibody Western Blot Protocol

Product Datasheet Link: LIPG antibody (ARP30655_P050)

WB Suggested Anti-LIPG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7

Western Blot image:

Description of Target: LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s LIPG antibody (ARP30655_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question