website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

LIPG antibody - middle region (ARP30655_P050)

Receive a free positive control (AHL009) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Lipase, endothelial
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express LIPG.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Endothelial lipase
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
CCL11, CCL13, CCL14, CCL19, CCL2, CCL21, CCL25, CCL27, CCL28, CCL3, CCL3L3, CCL4, CCL5, CCL7, CCL8, CCL13, CCL14, CCL5, CCL7, CCL8, Ccl2, Ccl3
The immunogen for anti-LIPG antibody: synthetic peptide directed towards the middle region of human LIPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
LIPG antibody - middle region (ARP30655_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 82%; Mouse: 77%
Species Reactivity:
Human, Rabbit, Dog, Horse, Guinea pig, Sheep, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-LIPG antibody
- ARP30655_P050
Peptide Sequence:
Synthetic peptide located within the following region: VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP
Blocking Peptide:
For anti-LIPG antibody is Catalog # AAP30655 (Previous Catalog # AAPP01312)
Additional Information:
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Willer,C.J., (2008) Nat. Genet. 40 (2), 161-169
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for LIPG antibody (ARP30655)

Product page for LIPG antibody (ARP30655)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Dog LIPG antibody; Canis familiaris LIPG antibody E2R774 100%
Dog LIPG antibody; Canis familiaris LIPG antibody F1Q4K5 100%
Duckbill platypus 100082098 antibody; Ornithorhynchus anatinus 100082098 antibody F6VS71 78%
Gray short-tailed opossum LIPG antibody; Monodelphis domestica LIPG antibody F7G148 81%
Gray short-tailed opossum LIPG antibody; Monodelphis domestica LIPG antibody F7G131 81%
Guinea pig LIPG antibody; Cavia porcellus LIPG antibody H0VDD5 100%
Hamadryas baboon LIPG antibody; Papio hamadryas LIPG antibody A7LD44 100%
Horse LIPG antibody; Equus caballus LIPG antibody F6TN81 100%
Human LIPE antibody; Homo sapiens LIPE antibody Q9Y5X9 100%
Human LIPG antibody; Homo sapiens LIPG antibody B4DTR8 100%
Lowland gorilla LIPG antibody; Gorilla gorilla gorilla LIPG antibody G3QE94 100%
Mouse LIPE antibody; Mus musculus LIPE antibody Q9WVG5 76%
Mouse Lipg antibody; Mus musculus Lipg antibody Q3UDI6 76%
Mouse Lipg antibody; Mus musculus Lipg antibody Q3U807 76%
Mouse Lipg antibody; Mus musculus Lipg antibody Q3TA44 76%
Mouse Lipg antibody; Mus musculus Lipg antibody C0LQ91 76%
Northern white-cheeked gibbon LIPG antibody; Nomascus leucogenys LIPG antibody G1RLF6 100%
Pig LIPG antibody; Sus scrofa LIPG antibody F1RPQ9 100%
Rabbit LIPG antibody; Oryctolagus cuniculus LIPG antibody D5FGX9 100%
Rhesus macaque LIPG antibody; Macaca mulatta LIPG antibody F6QUF1 100%
Small-eared galago LIPG antibody; Otolemur garnettii LIPG antibody H0XFJ2 100%
Tasmanian devil LIPG antibody; Sarcophilus harrisii LIPG antibody G3VR16 83%
White-tufted-ear marmoset LIPG antibody; Callithrix jacchus LIPG antibody F7IS07 100%
White-tufted-ear marmoset LIPG antibody; Callithrix jacchus LIPG antibody F6V0B4 100%

Product Protocols: LIPG antibody tested with Human Mcf7 Cells (ARP30655_P050)

Aviva Systems Biology is the original manufacturer of this LIPG antibody (ARP30655_P050)

Click here to view the LIPG antibody Western Blot Protocol

Product Datasheet Link: LIPG antibody (ARP30655_P050)

WB Suggested Anti-LIPG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7

Western Blot image:

Description of Target: LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s LIPG antibody (ARP30655_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question