website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

LIPG antibody - middle region (ARP30655_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30655_P050-FITC Conjugated

ARP30655_P050-HRP Conjugated

ARP30655_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Lipase, endothelial
Protein Name:
Endothelial lipase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-46937 from Santa Cruz Biotechnology.
Description of Target:
LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LIPG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LIPG.
The immunogen is a synthetic peptide directed towards the middle region of human LIPG
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 77%; Rabbit: 100%; Rat: 82%; Sheep: 100%
Complete computational species homology data:
Anti-LIPG (ARP30655_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LIPG (ARP30655_P050) antibody is Catalog # AAP30655 (Previous Catalog # AAPP01312)
Datasheets / Downloads:
Printable datasheet for anti-LIPG (ARP30655_P050) antibody
Additional Information:
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Willer,C.J., (2008) Nat. Genet. 40 (2), 161-169

Product Protocols: LIPG antibody tested with Human Mcf7 Cells (ARP30655_P050)

Aviva Systems Biology is the original manufacturer of this LIPG antibody (ARP30655_P050)

Click here to view the LIPG antibody Western Blot Protocol

Product Datasheet Link: LIPG antibody (ARP30655_P050)

WB Suggested Anti-LIPG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7

Western Blot image:

Description of Target: LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s LIPG antibody (ARP30655_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...