website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

LIPG antibody - middle region (ARP30655_P050)

Receive a free positive control (AHL009) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Lipase, endothelial
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express LIPG.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Endothelial lipase
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
CCL11, CCL13, CCL14, CCL19, CCL2, CCL21, CCL25, CCL27, CCL28, CCL3, CCL3L3, CCL4, CCL5, CCL7, CCL8, CCL13, CCL14, CCL5, CCL7, CCL8, Ccl2, Ccl3
The immunogen for anti-LIPG antibody: synthetic peptide directed towards the middle region of human LIPG
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
LIPG antibody - middle region (ARP30655_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 82%; Mouse: 77%
Species Reactivity:
Human, Rabbit, Dog, Horse, Guinea pig, Sheep, Rat, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-LIPG antibody
- ARP30655_P050
Peptide Sequence:
Synthetic peptide located within the following region: VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP
Blocking Peptide:
For anti-LIPG antibody is Catalog # AAP30655 (Previous Catalog # AAPP01312)
Additional Information:
IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Key Reference:
Willer,C.J., (2008) Nat. Genet. 40 (2), 161-169
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-LIPG antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question