KLHL3 Antibody - N-terminal region (ARP34818_P050)

Catalog No: ARP34818_P050

Host: Rabbit
Target Name: KLHL3
Sample Type: Breast Tumor lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLHL3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 90%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: HMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KLHL3 (ARP34818_P050) antibody is Catalog # AAP34818

Target Info

• Gene Symbol: KLHL3
• Gene Full Name: kelch-like 3 (Drosophila)
• Alias Symbols: PHA2D
• NCBI Gene Id: 26249
• Protein Name: Kelch-like protein 3
• Description of Target: KLHL3 protein contains a poxvirus and zinc finger domain at the N-terminus and six tandem repeats (kelch repeats) at the C-terminus. At the amino acid level, KLHL3 shares 77% similarity with Drosophila kelch and 89% similarity with Mayven (KLHL2), another human kelch homolog. At least three isoforms are produced and may be the result of alternative promoter usage. The KLHL3 maps within the smallest commonly deleted segment in myeloid leukemias characterized by a deletion of 5q; however, no inactivating mutations of KLHL3 could be detected in malignant myeloid disorders with loss of 5q.
• Uniprot ID: Q9UH77-3
• Protein Size (# AA): 505
• Molecular Weight: 55kDa
• Protein Interactions: WNK4; KLHL12; KLHL3; KEAP1; MORF4L2; CUL3; UBC; C6orf165; WNK3; WNK2; WNK1; RBX1; SLC12A3; ELAVL1; SYNCRIP; SYT2; OPRD1; GNAO1; GNAI1;