IL19 Antibody - middle region (ARP64069_P050)

Catalog No: ARP64069_P050

WB Suggested Anti-IL19 Antibody Titration: 1 ug/ml
Positive Control: Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Human: 100%; Rabbit: 79%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: ILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IL19 (ARP64069_P050) antibody is Catalog # AAP64069

Target Info

• Gene Symbol: IL19
• Gene Full Name: Interleukin 19
• Alias Symbols: MDA1, NG.1, ZMDA1, IL-10C
• NCBI Gene Id: 29949
• Protein Name: Interleukin 19 EMBL CAH71814.1
• Description of Target: The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.
• Uniprot ID: Q5VUT3
• Protein Accession #: NP_715639
• Nucleotide Accession #: NM_153758
• Protein Size (# AA): 215
• Molecular Weight: 18kDa
• Protein Interactions: IL20RA;