HLA-DMA Antibody - N-terminal region (ARP61256_P050)

Catalog No: ARP61256_P050

WB Suggested Anti-HLA-DMA Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Dog, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-DMA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 77%; Human: 100%; Rabbit: 82%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HLA-DMA (ARP61256_P050) antibody is Catalog # AAP61256 (Previous Catalog # AAPP47402)

Target Info

• Gene Symbol: HLA-DMA
• Gene Full Name: Major histocompatibility complex, class II, DM alpha
• Alias Symbols: DMA, HLADM, RING6, D6S222E
• NCBI Gene Id: 3108
• Protein Name: DMA protein EMBL CAA60781.1
• Description of Target: HLA-DMA belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta chain (DMB), both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail.
• Uniprot ID: Q31604
• Protein Accession #: NP_006111
• Nucleotide Accession #: NM_006120
• Protein Size (# AA): 261
• Molecular Weight: 29kDa
• Protein Interactions: B3GAT1; U2AF2; RUNX1; UBC; CD82; HLA-DRB1; HLA-DOA; HLA-DRA; HLA-DMB; CD74;