GPR78 Antibody - C-terminal region (ARP65763_P050)

Catalog No: ARP65763_P050

WB Suggested Anti-GPR78 Antibody
Titration: 1.0 ug/ml
Positive Control: OVCAR-3 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR78
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GPR78 (ARP65763_P050) antibody is Catalog # AAP65763

Target Info

• Gene Symbol: GPR78
• Alias Symbols: -
• NCBI Gene Id: 27201
• Protein Name: G-protein coupled receptor 78
• Description of Target: The protein encoded by this gene belongs to the G protein-coupled receptor family, which contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. This is an orphan receptor, which displays significant level of constitutive activity. Association analysis shows preliminary evidence for the involvement of this gene in susceptibility to bipolar affective disorder and schizophrenia. Alternatively spliced transcript variants have been found for this gene.
• Uniprot ID: Q96P69
• Protein Accession #: NP_543009
• Nucleotide Accession #: NM_080819
• Protein Size (# AA): 363
• Molecular Weight: 39kDa
• Protein Interactions: APP;