AKR1D1 Antibody - middle region (ARP60804_P050)

Catalog No: ARP60804_P050

WB Suggested Anti-AKR1D1 Antibody
Titration: 1.0 ug/ml
Positive Control: RPMI-8226 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKR1D1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 100%; Rat: 77%
• Peptide Sequence: Synthetic peptide located within the following region: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AKR1D1 (ARP60804_P050) antibody is Catalog # AAP60804 (Previous Catalog # AAPP46989)

Target Info

• Gene Symbol: AKR1D1
• Gene Full Name: Aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
• Alias Symbols: CBAS2, SRD5B1, 3o5bred
• NCBI Gene Id: 6718
• Protein Name: 3-oxo-5-beta-steroid 4-dehydrogenase
• Description of Target: The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.
• Uniprot ID: P51857
• Protein Accession #: NP_005980
• Nucleotide Accession #: NM_005989
• Protein Size (# AA): 326
• Molecular Weight: 37kDa