TRIOBP Antibody - middle region (ARP34718_P050)

Catalog No: ARP34718_P050

WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Rabbit Anti-TRIOBP Antibody
Catalog Number: ARP34718
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIOBP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: QIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPTSAPDVTKLSDSNKENAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRIOBP (ARP34718_P050) antibody is Catalog # AAP34718 (Previous Catalog # AAPP05912)
• Reference: Yu,J., (2008) Biochem. Biophys. Res. Commun. 367 (4), 805-812

Target Info

• Gene Symbol: TRIOBP
• Gene Full Name: TRIO and F-actin binding protein
• Alias Symbols: TARA, TAP68, DFNB28, dJ37E16.4, HRIHFB2122
• NCBI Gene Id: 11078
• Description of Target: TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. The protein also associates with F-actin and stabilizes F-actin structures. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness.This gene encodes a protein that interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. This trio-binding protein also associates with F-actin and stabilizes F-actin structures. Domains contained in this encoded protein are an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness. Multiple alternatively spliced transcript variants that would encode different isoforms have been found for this gene, however some transcripts may be subject to nonsense-mediated decay (NMD).
• Uniprot ID: Q9H2D6
• Protein Accession #: NP_619538
• Nucleotide Accession #: NM_138632
• Protein Size (# AA): 431
• Molecular Weight: 47 kDa
• Protein Interactions: POLR1C; IKBKG; GTF2H1; PLK1; ELAVL1; VIM; HECTD3; UBC;