TRIM62 Antibody - middle region (ARP39342_P050)

Catalog No: ARP39342_P050

WB Suggested Anti-TRIM62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM62
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TRIM62 (ARP39342_P050) antibody is Catalog # AAP39342 (Previous Catalog # AAPP21354)
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Target Info

• Gene Symbol: TRIM62
• Gene Full Name: Tripartite motif containing 62
• Alias Symbols: DEAR1
• NCBI Gene Id: 55223
• Protein Name: Tripartite motif-containing protein 62
• Description of Target: TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.
• Uniprot ID: Q9BVG3
• Protein Accession #: NP_060677
• Nucleotide Accession #: NM_018207
• Protein Size (# AA): 475
• Molecular Weight: 54kDa
• Protein Interactions: SMAD3; UBC; SKIL; SMAD2;