SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46418_T100
Price: $0.00
SKU
ARP46418_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TMPRSS11D (ARP46418_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TMPRSS11D
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 79%; Horse: 79%; Human: 100%; Rabbit: 79%
Peptide SequenceSynthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA
Concentration1.0 mg/ml
Blocking PeptideFor anti-TMPRSS11D (ARP46418_T100) antibody is Catalog # AAP46418 (Previous Catalog # AAPS18108)
ReferenceMatsushima,R., Am. J. Physiol. Lung Cell Mol. Physiol. 290 (2), L385-L395 (2006)
Gene SymbolTMPRSS11D
Gene Full NameTransmembrane protease, serine 11D
Alias SymbolsASP, HAT
NCBI Gene Id9407
Protein NameTransmembrane protease serine 11D
Description of TargetTMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.This gene encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
Uniprot IDO60235
Protein Accession #NP_004253
Nucleotide Accession #NM_004262
Protein Size (# AA)418
Molecular Weight46kDa
  1. What is the species homology for "TMPRSS11D Antibody - N-terminal region (ARP46418_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TMPRSS11D Antibody - N-terminal region (ARP46418_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TMPRSS11D Antibody - N-terminal region (ARP46418_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TMPRSS11D Antibody - N-terminal region (ARP46418_T100)"?

    This target may also be called "ASP, HAT" in publications.

  5. What is the shipping cost for "TMPRSS11D Antibody - N-terminal region (ARP46418_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TMPRSS11D Antibody - N-terminal region (ARP46418_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TMPRSS11D Antibody - N-terminal region (ARP46418_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TMPRSS11D Antibody - N-terminal region (ARP46418_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TMPRSS11D"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TMPRSS11D"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TMPRSS11D"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TMPRSS11D"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TMPRSS11D"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TMPRSS11D"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TMPRSS11D Antibody - N-terminal region (ARP46418_T100)
Your Rating
We found other products you might like!