THEG Antibody - middle region (ARP57809_P050)

Catalog No: ARP57809_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-THEG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THEG
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LKDRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-THEG (ARP57809_P050) antibody is Catalog # AAP57809 (Previous Catalog # AAPP45017)

Target Info

• Gene Symbol: THEG
• Gene Full Name: Theg spermatid protein
• Alias Symbols: CT56, THEG1
• NCBI Gene Id: 51298
• Protein Name: Testicular haploid expressed gene protein
• Description of Target: This gene is specifically expressed in the nucleus of haploid male germ cells. It encodes a protein that may be involved in the regulation of germ cell nuclear functions. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Uniprot ID: Q9P2T0-2
• Protein Accession #: NP_954672
• Nucleotide Accession #: NM_199202
• Protein Size (# AA): 355
• Molecular Weight: 41kDa
• Protein Interactions: MDFI; CCT5;