TGIF1 Antibody - C-terminal region (ARP51343_P050)

Catalog No: ARP51343_P050

WB Suggested Anti-TGIF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TGIF1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 86%; Sheep: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TGIF1 (ARP51343_P050) antibody is Catalog # AAP51343 (Previous Catalog # AAPS23608)
• Reference: Inoue,N., (2008) Brain Dev. 30 (3), 203-205

Target Info

• Gene Symbol: TGIF1
• Gene Full Name: TGFB-induced factor homeobox 1
• Alias Symbols: HPE4, TGIF
• NCBI Gene Id: 7050
• Protein Name: Homeobox protein TGIF1
• Description of Target: TGIF1 is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain.The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain. Alternative splicing has been observed at this locus and eight variants, encoding four distinct isoforms, are described.
• Uniprot ID: Q15583
• Protein Accession #: NP_733796
• Nucleotide Accession #: NM_170695
• Protein Size (# AA): 401
• Molecular Weight: 43kDa
• Protein Interactions: MDFI; CTBP2; CTBP1; APP; PML; ELAVL1; HDAC1; A2M; AR; SIN3A; SMAD3; LRIF1; MED31; MAPK3; SMAD2; MAPK1; JUN; HMGB1; EEF1A1; FOXH1; SMAD1; SDAD1; STK16; MKKS;