TFAM Antibody - N-terminal region (ARP31400_P050)

Catalog No: ARP31400_P050 (Formerly GWB-22C6C2)

WB Suggested Anti-TFAM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

TFAM antibody - N-terminal region (ARP31400_P050) validated by WB using bEND3 cell lysate at lane1:10 ug, lane2:20 ug.

TFAM antibody - N-terminal region (ARP31400_P050) validated by WB using bEND3 cell lysate at lane1:10 ug, lane2:20 ug.

Lanes:
Lane 1 and 2: HepG2 cell lysate
Lane 3 and 4: Hep3B cell lysate
Lane 5 and 6: K562 cell lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:

Secondary Antibody Dilution:
1:1000
Gene Name:
TFAM
Submitted by:
Anonymous

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAM
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 83%; Guinea Pig: 75%; Horse: 92%; Human: 100%; Mouse: 75%; Pig: 92%; Rabbit: 83%
• Peptide Sequence: Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TFAM (ARP31400_P050) antibody is Catalog # AAP31400 (Previous Catalog # AAPP03075)
• Reference: Cruzen,M.E., Gene 362, 125-132 (2005)
• Publications:

  Alterations of mitochondrial biogenesis in chronic lymphocytic leukemia cells with loss of p53. Mitochondrion. 31, 33-39 (2016). 27650502

  Effect of aging on mitochondria and metabolism of bovine granulosa cells. J Reprod Dev. NULL, NULL (2020). 32921645

  Kemper, M. F., Stirone, C., Krause, D. N., Duckles, S. P. & Procaccio, V. Genomic and non-genomic regulation of PGC1 isoforms by estrogen to increase cerebral vascular mitochondrial biogenesis and reactive oxygen species protection. Eur. J. Pharmacol. 723, 322-9 (2014). 24275351

  Kemper, M. F., Zhao, Y., Duckles, S. P. & Krause, D. N. Endogenous ovarian hormones affect mitochondrial efficiency in cerebral endothelium via distinct regulation of PGC-1 isoforms. J. Cereb. Blood Flow Metab. 33, 122-8 (2013). 23093066

  Lu, W. et al. ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction. Cell Death Dis. 3, e422 (2012). 23152058

  Miyazaki, T. et al. Intracellular and extracellular ATP coordinately regulate the inverse correlation between osteoclast survival and bone resorption. J. Biol. Chem. 287, 37808-23 (2012). 22988253

  Shi, X. et al. Paradoxical effect of mitochondrial respiratory chain impairment on insulin signaling and glucose transport in adipose cells. J. Biol. Chem. 283, 30658-67 (2008). 18779333

  Teodoro, J. S. et al. Berberine reverts hepatic mitochondrial dysfunction in high-fat fed rats: a possible role for SirT3 activation. Mitochondrion 13, 637-46 (2013). 24041461

  Vettor, R. et al. Exercise training boosts eNOS-dependent mitochondrial biogenesis in mouse heart: role in adaptation of glucose metabolism. Am. J. Physiol. Endocrinol. Metab. 306, E519-28 (2014). 24381004

  Walters, M. W., Bjork, J. A. & Wallace, K. B. Perfluorooctanoic acid stimulated mitochondrial biogenesis and gene transcription in rats. Toxicology 264, 10-5 (2009). 19616056

  Zc3h10 is a novel mitochondrial regulator. EMBO Rep. 19, (2018). 29507079

  Zc3h10 regulates adipogenesis by controlling translation and F-actin/mitochondria interaction. J Cell Biol. 220 (2021). 33566069

• Description:
  View product citations for TFAM Antibody - N-terminal region (ARP31400_P050) on CiteAb

Target Info

• Gene Symbol: TFAM
• Gene Full Name: Transcription factor A, mitochondrial
• Alias Symbols: TCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS15
• NCBI Gene Id: 7019
• Protein Name: Transcription factor A, mitochondrial
• Description of Target: The function remains unknown.This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
• Uniprot ID: Q00059
• Protein Accession #: NP_003192
• Nucleotide Accession #: NM_003201
• Protein Size (# AA): 246
• Molecular Weight: 29kDa
• Protein Interactions: AGTRAP; FBXW11; ARL6IP1; NEDD1; PPP2R1A; GRSF1; UBC; MDM2; SUZ12; EED; PAN2; MYC; FN1; C1QBP; CAND1; COPS5; CUL3; ELAVL1; ICT1; TFB2M; TFB1M; PNP; NRF1;