TESPA1 Antibody - C-terminal region (ARP70645_P050)

Catalog No: ARP70645_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: TESPA1
Sample Type: Jurkat Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TESPA1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 86%
• Peptide Sequence: Synthetic peptide located within the following region: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TESPA1 (ARP70645_P050) antibody is Catalog # AAP70645

Target Info

• Gene Symbol: TESPA1
• Alias Symbols: HSPC257, ITPRID3, KIAA0748
• NCBI Gene Id: 9840
• Description of Target: TESPA1 is required for the development and maturation of T-cells, its function being essential for the late stages of thymocyte development. It plays a role in T-cell antigen receptor (TCR)-mediated activation of the ERK and NFAT signaling pathways, possibly by serving as a scaffolding protein that promotes the assembly of the LAT signalosome in thymocytes.
• Uniprot ID: A2RU30-2
• Protein Accession #: XP_005269304
• Protein Size (# AA): 383
• Molecular Weight: 42kDa
• Protein Interactions: UBC;