SLC39A7 Antibody - N-terminal region (ARP43812_P050)

Catalog No: ARP43812_P050

WB Suggested Anti-SLC39A7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC39A7 (ARP43812_P050) antibody is Catalog # AAP43812 (Previous Catalog # AAPS14009)
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Target Info

• Gene Symbol: SLC39A7
• Gene Full Name: Solute carrier family 39 (zinc transporter), member 7
• Alias Symbols: KE4, HKE4, ZIP7, RING5, H2-KE4, D6S115E, D6S2244E
• NCBI Gene Id: 7922
• Protein Name: Zinc transporter SLC39A7
• Description of Target: Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.[supplied by OMIM].
• Uniprot ID: Q92504
• Protein Accession #: NP_001070984
• Nucleotide Accession #: NM_001077516
• Protein Size (# AA): 469
• Molecular Weight: 50kDa
• Protein Interactions: UBC; SUZ12; BMI1; YY1; SUMO1; USP49; RGS20; CD40;