SLC27A4 Antibody - middle region (ARP43901_P050)

Catalog No: ARP43901_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-SLC27A4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

WB Suggested Anti-SLC27A4 antibody Titration: 1 ug/mL
Sample Type: Human MCF7

Host: Rabbit
Target: SLC27A4
Positive control (+): 293T Cell Lysate (2T)
Negative control (-): Human Lung (LU)
Antibody concentration: 0.2ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC27A4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SLC27A4 (ARP43901_P050) antibody is Catalog # AAP43901 (Previous Catalog # AAPP25436)
• Reference: Jia,Z., (2007) J. Mol. Neurosci. 33 (1), 25-31

Target Info

• Gene Symbol: SLC27A4
• Gene Full Name: Solute carrier family 27 (fatty acid transporter), member 4
• Alias Symbols: IPS, FATP4, ACSVL4
• NCBI Gene Id: 10999
• Protein Name: Long-chain fatty acid transport protein 4
• Description of Target: SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. It appears to be the principal fatty acid transporter in small intestinal enterocytes. SLC27A4 plays a role in the formation of the epidermal barrier. It is required for fat absorption in early embryogenesis. SLC27A4 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
• Uniprot ID: Q6P1M0
• Protein Accession #: NP_005085
• Nucleotide Accession #: NM_005094
• Protein Size (# AA): 643
• Molecular Weight: 72kDa
• Protein Interactions: UBC; EPS8; vpu; BECN1; TMBIM4;