SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33062_P050
Price: $0.00
SKU
ARP33062_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-POU3F3 (ARP33062_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human POU3F3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAA
Concentration0.5 mg/ml
Blocking PeptideFor anti-POU3F3 (ARP33062_P050) antibody is Catalog # AAP33062 (Previous Catalog # AAPP04091)
Sample Type Confirmation

POU3F3 is supported by BioGPS gene expression data to be expressed in OVCAR3

ReferenceWissmuller,S., (2006) (er) Nucleic Acids Res. 34 (6), 1735-1744
Gene SymbolPOU3F3
Gene Full NamePOU class 3 homeobox 3
Alias SymbolsBRN1, OTF8, oct-8, SNIBFIS, brain-1
NCBI Gene Id5455
Protein NamePOU domain, class 3, transcription factor 3
Description of TargetPOU3F3 is the transcription factor that acts synergistically with SOX11 and SOX4. POU3F3 plays a role in neuronal development. POU3F3 is implicated in an enhancer activity at the embryonic met-mesencephalic junction; the enhancer element contains the octamer motif (5'-ATTTGCAT-3').POU3F3 is a member of the class III POU family of transcription factors (see POU3F1; MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences Sumiyama et al. (1996) [PubMed 8703082].[supplied by OMIM].
Uniprot IDP20264
Protein Accession #NP_006227
Nucleotide Accession #NM_006236
Protein Size (# AA)500
Molecular Weight50kDa
Protein InteractionsDlg4; SOX8; PPP1R15A; SOX10; SOX11; POU3F4;
  1. What is the species homology for "POU3F3 Antibody - N-terminal region (ARP33062_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "POU3F3 Antibody - N-terminal region (ARP33062_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "POU3F3 Antibody - N-terminal region (ARP33062_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "POU3F3 Antibody - N-terminal region (ARP33062_P050)"?

    This target may also be called "BRN1, OTF8, oct-8, SNIBFIS, brain-1" in publications.

  5. What is the shipping cost for "POU3F3 Antibody - N-terminal region (ARP33062_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "POU3F3 Antibody - N-terminal region (ARP33062_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "POU3F3 Antibody - N-terminal region (ARP33062_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "POU3F3 Antibody - N-terminal region (ARP33062_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "POU3F3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "POU3F3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "POU3F3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "POU3F3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "POU3F3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "POU3F3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:POU3F3 Antibody - N-terminal region (ARP33062_P050)
Your Rating
We found other products you might like!