PIWIL2 Antibody (ARP57108_P050)

Catalog No: ARP57108_P050 (Formerly GWB-MU678C)

WB Suggested Anti-PIWIL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Small Intestine

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 85%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PIWIL2 (ARP57108_P050) antibody is Catalog # AAP57108 (Previous Catalog # AAPP35436)
• Reference: Lee,J.H., (2006) Hum. Mol. Genet. 15 (2), 201-211

Target Info

• Gene Symbol: PIWIL2
• Gene Full Name: Piwi-like 2 (Drosophila)
• Alias Symbols: CT80, HILI, mili, PIWIL1L
• NCBI Gene Id: 55124
• Protein Name: Piwi-like protein 2
• Description of Target: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).
• Uniprot ID: Q8TC59
• Protein Accession #: NP_060538
• Nucleotide Accession #: NM_018068
• Protein Size (# AA): 973
• Molecular Weight: 110kDa
• Protein Interactions: HSP90AA1; DICER1; DDX4;