website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

MRPL3 antibody - N-terminal region (ARP62688_P050)

Description of Target:
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
Gene Symbol:
Official Gene Full Name:
Mitochondrial ribosomal protein L3
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express MRPL3.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
39S ribosomal protein L3, mitochondrial
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
MRPL3 antibody - N-terminal region (ARP62688_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 86%; Mouse: 79%
Species Reactivity:
Human, Rabbit, Rat, Guinea pig, Dog, Horse, Bovine, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-MRPL3 antibody
- ARP62688_P050
Peptide Sequence:
Synthetic peptide located within the following region: MPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFR
Blocking Peptide:
For anti-MRPL3 antibody is Catalog # AAP62688
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MRPL3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for MRPL3 antibody (ARP62688)

Product page for MRPL3 antibody (ARP62688)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100661668 antibody; Loxodonta africana LOC100661668 antibody G3T8X3 78%
Bovine RM03 antibody; Bos taurus RM03 antibody Q3ZBX6 85%
Dog LOC100856435 antibody; Canis familiaris LOC100856435 antibody E2R429 85%
Gray short-tailed opossum MRPL3 antibody; Monodelphis domestica MRPL3 antibody F7G715 83%
Gray short-tailed opossum MRPL3 antibody; Monodelphis domestica MRPL3 antibody F7G2U5 83%
Guinea pig LOC100725236 antibody; Cavia porcellus LOC100725236 antibody H0WDQ8 92%
Horse MRPL3 antibody; Equus caballus MRPL3 antibody F6YS16 85%
Human MRPL3 antibody; Homo sapiens MRPL3 antibody H0Y9G6 100%
Human MRPL3 antibody; Homo sapiens MRPL3 antibody E7ETU7 100%
Human MRPL3 antibody; Homo sapiens MRPL3 antibody D6RC14 100%
Human RM03 antibody; Homo sapiens RM03 antibody P09001 100%
Lowland gorilla MRPL3 antibody; Gorilla gorilla gorilla MRPL3 antibody G3SD27 92%
Lowland gorilla MRPL3 antibody; Gorilla gorilla gorilla MRPL3 antibody G3R6A6 92%
Mouse Mrpl3 antibody; Mus musculus Mrpl3 antibody Q91XB2 78%
Mouse Mrpl3 antibody; Mus musculus Mrpl3 antibody Q05DC5 78%
Mouse Mrpl3 antibody; Mus musculus Mrpl3 antibody F6W7C7 78%
Mouse Mrpl3 antibody; Mus musculus Mrpl3 antibody D3Z456 78%
Mouse RM03 antibody; Mus musculus RM03 antibody Q99N95 78%
Northern white-cheeked gibbon MRPL3 antibody; Nomascus leucogenys MRPL3 antibody G1QRG1 92%
Pig MRPL3 antibody; Sus scrofa MRPL3 antibody F1RX24 84%
Rabbit LOC100353979 antibody; Oryctolagus cuniculus LOC100353979 antibody G1SIP9 92%
Rat Mrpl3 antibody; Rattus norvegicus Mrpl3 antibody G3V7P3 78%
Rat RM03 antibody; Rattus norvegicus RM03 antibody P18665 78%
Rhesus macaque MRPL3 antibody; Macaca mulatta MRPL3 antibody F6XHQ0 92%
Small-eared galago MRPL3 antibody; Otolemur garnettii MRPL3 antibody H0XEQ6 85%
White-tufted-ear marmoset LOC100410167 antibody; Callithrix jacchus LOC100410167 antibody F7IC72 78%
White-tufted-ear marmoset LOC100410167 antibody; Callithrix jacchus LOC100410167 antibody F7IC68 78%
Ask a Question