website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

MRPL3 antibody - N-terminal region (ARP62688_P050)

Description of Target:
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
Gene Symbol:
MRPL3
Official Gene Full Name:
Mitochondrial ribosomal protein L3
NCBI Gene Id:
11222
Alias Symbols:
MRL3; RPML3
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MRPL3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MRPL3.
Swissprot Id:
P09001
Protein Accession #:
NP_009139
Nucleotide Accession #:
NM_007208
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
39S ribosomal protein L3, mitochondrial
Protein Size (# AA):
348
Molecular Weight:
38kDa
Application:
WB
Protein Interactions:
UBC; MRPS27; mug82; ICT1; C1QBP; MRPL55; MRPL10; MRPL52; MRPL9; MRPL41; MRPS9; MRPL17; MRPL39; MRPL4; MRPL13; MRPL42; MRPL46; MRPL19; RPS18; RPS15; MRPL12; MRPL23; NDUFS3; APP; CAND1;
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-MRPL3 (ARP62688_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-MRPL3 (ARP62688_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: MPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFR
Blocking Peptide:
For anti-MRPL3 (ARP62688_P050) antibody is Catalog # AAP62688
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question