website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MRPL3 antibody - N-terminal region (ARP62688_P050)

  • Catalog#: ARP62688_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Mitochondrial ribosomal protein L3
    Protein Name:
    39S ribosomal protein L3, mitochondrial
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    MRL3, RPML3
    Description of Target:
    Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express MRPL3.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express MRPL3.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93%
    Complete computational species homology data:
    Anti-MRPL3 (ARP62688_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFR
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; MRPS27; mug82; ICT1; C1QBP; MRPL55; MRPL10; MRPL52; MRPL9; MRPL41; MRPS9; MRPL17; MRPL39; MRPL4; MRPL13; MRPL42; MRPL46; MRPL19; RPS18; RPS15; MRPL12; MRPL23; NDUFS3; APP; CAND1;
    Blocking Peptide:
    For anti-MRPL3 (ARP62688_P050) antibody is Catalog # AAP62688
    Datasheets / Downloads:
    Printable datasheet for anti-MRPL3 (ARP62688_P050) antibody
    Ask a Question