MRPL3 antibody - N-terminal region (ARP62688_P050)

Catalog#: ARP62688_P050

• Size: 50ug

Human Placenta

• Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
• Gene Symbol: MRPL3
• Official Gene Full Name: Mitochondrial ribosomal protein L3
• Alias Symbols: MRL3; RPML3
• Protein Accession#: NP_009139
• Nucleotide Accession#: NM_007208
• Swissprot Id: P09001
• Host: Rabbit
• Protein Size (# AA): 348
• Molecular Weight: 38kDa
• Application: WB
• Partner Proteins: ICT1
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Horse: 85%; Pig: 84%; Mouse: 78%; Rat: 78%
• Peptide Sequence: Synthetic peptide located within the following region: MPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFR
• Blocking Peptide: For anti-MRPL3 antibody is Catalog # AAP62688
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-MRPL3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.