website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

MRPL3 antibody - N-terminal region (ARP62688_P050)

Description of Target:
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
Gene Symbol:
MRPL3
Official Gene Full Name:
Mitochondrial ribosomal protein L3
NCBI Gene Id:
11222
Alias Symbols:
MRL3; RPML3
Tissue Tool:
Find tissues and cell lines supported to express MRPL3.
Protein Accession #:
NP_009139
Nucleotide Accession#:
NM_007208
Swissprot Id:
P09001
Host:
Rabbit
Protein Name:
39S ribosomal protein L3, mitochondrial
Protein Size (# AA):
348
Molecular Weight:
38kDa
Application:
WB
Partner Proteins:
ICT1
Product Format:
Lyophilized powder
Complete computational species homology data:
MRPL3 antibody - N-terminal region (ARP62688_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 86%; Mouse: 79%
Species Reactivity:
Human, Rabbit, Rat, Guinea pig, Dog, Horse, Bovine, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-MRPL3 antibody
- ARP62688_P050
Peptide Sequence:
Synthetic peptide located within the following region: MPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFR
Blocking Peptide:
For anti-MRPL3 antibody is Catalog # AAP62688
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MRPL3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question