GSTA4 Antibody - N-terminal region (ARP48554_P050)

Catalog No: ARP48554_P050

WB Suggested Anti-GSTA4 Antibody
Titration: 1.0 ug/ml
Positive Control: THP-1 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSIL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GSTA4 (ARP48554_P050) antibody is Catalog # AAP48554

Target Info

• Gene Symbol: GSTA4
• Gene Full Name: Glutathione S-transferase alpha 4
• Alias Symbols: GTA4, GSTA4-4
• NCBI Gene Id: 2941
• Protein Name: Glutathione S-transferase A4
• Description of Target: GSTA4 is a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.
• Uniprot ID: O15217
• Protein Accession #: NP_001503
• Nucleotide Accession #: NM_001512
• Protein Size (# AA): 222
• Molecular Weight: 26kDa
• Protein Interactions: C2orf50; GSTA4; GSTA2; BAG3; UBC;