GLIPR1 Antibody - middle region (ARP64655_P050)

Catalog No: ARP64655_P050

WB Suggested Anti-GLIPR1 Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GLIPR1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GLIPR1 (ARP64655_P050) antibody is Catalog # AAP64655

Target Info

• Gene Symbol: GLIPR1
• Alias Symbols: GLIPR, RTVP1, CRISP7
• NCBI Gene Id: 11010
• Protein Name: Glioma pathogenesis-related protein 1
• Description of Target: This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
• Uniprot ID: P48060
• Protein Accession #: NP_006842
• Nucleotide Accession #: NM_006851
• Protein Size (# AA): 266
• Molecular Weight: 28kDa
• Protein Interactions: UBC;