GH1 Antibody - C-terminal region (ARP41763_P050)

Catalog No: ARP41763_P050

WB Suggested Anti-GH1 Antibody
Titration: 1.0 ug/ml
Positive Control: THP-1 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GH1 (ARP41763_P050) antibody is Catalog # AAP41763
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Gene Symbol: GH1
• Gene Full Name: Growth hormone 1
• Alias Symbols: GH, GHN, GH-N, GHB5, IGHD2, hGH-N, IGHD1A, IGHD1B
• NCBI Gene Id: 2688
• Protein Name: Growth hormone 1 Ensembl ENSP00000343791
• Description of Target: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
• Uniprot ID: A6NEF6
• Protein Accession #: NP_072054
• Nucleotide Accession #: NM_022560
• Protein Size (# AA): 217
• Molecular Weight: 25 kDa
• Protein Interactions: GHR; BAG3; BTRC; PRLR; GH1; SHC1; STRAP; LTA4H;