website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GAS7 antibody - N-terminal region (ARP30004_T100)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30004_T100-FITC Conjugated

ARP30004_T100-HRP Conjugated

ARP30004_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Growth arrest-specific 7
Protein Name:
Growth arrest-specific protein 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-292307 from Santa Cruz Biotechnology.
Description of Target:
The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GAS7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GAS7.
The immunogen is a synthetic peptide directed towards the N terminal region of human GAS7
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GAS7 (ARP30004_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GAS7 (ARP30004_T100) antibody is Catalog # AAP30004 (Previous Catalog # AAPH00104)
Datasheets / Downloads:
Printable datasheet for anti-GAS7 (ARP30004_T100) antibody
Target Reference:
Ju,Y.T., et al., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (19), 11423-11428

Product Protocols: GAS7 antibody tested with Human Fetal Cerebellum Tissue (ARP30004_T100)

Aviva Systems Biology is the original manufacturer of this GAS7 antibody (ARP30004_T100)

Click here to view the GAS7 antibody Western Blot Protocol

Product Datasheet Link: GAS7 antibody (ARP30004_T100)

WB Suggested Anti-GAS7 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal cerebellum

Western Blot image:

Description of Target: The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GAS7 antibody (ARP30004_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: GAS7 antibody tested by IHC with human muscle (ARP30004)

Aviva Systems Biology is the original manufacturer of this GAS7 antibody.

Click here to view the GAS7 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: GAS7 antibody (ARP30004)

IHC Information:

Rabbit Anti-GAS7 Antibody
Catalog Number: ARP30004
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...