website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

GAS7 antibody - N-terminal region (ARP30004_T100)

Description of Target:
The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.
Gene Symbol:
Official Gene Full Name:
Growth arrest-specific 7
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express GAS7.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Growth arrest-specific protein 7
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
GAS7 antibody - N-terminal region (ARP30004_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%
Species Reactivity:
Human, Bovine, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GAS7 antibody
- ARP30004_T100
Peptide Sequence:
Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK
Blocking Peptide:
For anti-GAS7 antibody is Catalog # AAP30004 (Previous Catalog # AAPH00104)
Key Reference:
Ju,Y.T., et al., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (19), 11423-11428
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-GAS7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question