FOXP2 Antibody - N-terminal region (ARP33750_P050)

Catalog No: ARP33750_P050

WB Suggested Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2

WB Suggested Anti-FOXP2 Antibody
Titration: 0.5ug/ml
Positive Control: HepG2 cell lysate

Rabbit Anti-FOXP2 Antibody
Catalog Number: ARP33750
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Goat, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
• Peptide Sequence: Synthetic peptide located within the following region: SGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FOXP2 (ARP33750_P050) antibody is Catalog # AAP33750 (Previous Catalog # AAPP04816)
• Specificity: isoform 4 and 5
• Reference: Sanjuan,J., et al., (2006) Psychiatr. Genet. 16 (2), 67-72

Target Info

• Gene Symbol: FOXP2
• Gene Full Name: Forkhead box P2
• Alias Symbols: SPCH1, CAGH44, TNRC10
• NCBI Gene Id: 93986
• Protein Name: Forkhead box protein P2
• Description of Target: FOXP2 is an evolutionarily conserved transcription factor expressed in fetal and adult brain. This transcription factor is a member of the forkhead/winged-helix (FOX) family of transcription factors, and contains a FOX DNA-binding domain and a large polyglutamine tract. Members of the FOX family of transcription factors are regulators of embryogenesis. The product of this gene is thought to be required for proper development of speech and language regions of the brain during embryogenesis. Although a point mutation in this gene has been associated with the KE pedigree segregating developmental verbal dyspraxia, no association between mutations in this gene and another speech disorder, autism, has been found. Four alternative transcripts encoding three different isoforms have been identified.
• Uniprot ID: O15409-5
• Protein Accession #: NP_055306
• Nucleotide Accession #: NM_014491
• Protein Size (# AA): 715
• Molecular Weight: 80kDa
• Protein Interactions: FAM124A; TSACC; RPIA; SP4; SDCBP; PIN1; CTBP2; CTBP1; CCNC; AES; MAPK3; HSP90AA1; GATAD2B; FOXP1; FOXP4; FOXP2;