SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP50111_P050
Price: $0.00
SKU
ARP50111_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FCRLA (ARP50111_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FCRLA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE
Concentration0.5 mg/ml
Blocking PeptideFor anti-FCRLA (ARP50111_P050) antibody is Catalog # AAP50111 (Previous Catalog # AAPY03341)
ReferenceTaylor,A.I., (2007) Immunogenetics 59 (4), 323-328
Gene SymbolFCRLA
Gene Full NameFc receptor-like A
Alias SymbolsFCRL, FCRX, FREB, FCRL1, FCRLX, FCRLb, FCRLd, FCRLe, FCRLM1, FCRLc1, FCRLc2
NCBI Gene Id84824
Protein NameFc receptor-like A
Description of TargetReceptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.Receptors for the Fc fragment of IgG, or FCGRs (see MIM 146790), are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. All FCGR genes map to human chromosome 1. Additional genes in this region, including FREB, encode FCGR homologs that are selectively expressed in B cells and may be implicated in B-cell development and lymphomagenesis.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-742 BM471887.1 3-744 743-1338 BC006521.2 558-1153 1339-1684 BX112608.1 318-663 1685-2357 BX649184.1 2243-2915
Uniprot IDQ7L513
Protein Accession #NP_116127
Nucleotide Accession #NM_032738
Protein Size (# AA)376
Molecular Weight41kDa
  1. What is the species homology for "FCRLA Antibody - C-terminal region (ARP50111_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "FCRLA Antibody - C-terminal region (ARP50111_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FCRLA Antibody - C-terminal region (ARP50111_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FCRLA Antibody - C-terminal region (ARP50111_P050)"?

    This target may also be called "FCRL, FCRX, FREB, FCRL1, FCRLX, FCRLb, FCRLd, FCRLe, FCRLM1, FCRLc1, FCRLc2" in publications.

  5. What is the shipping cost for "FCRLA Antibody - C-terminal region (ARP50111_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FCRLA Antibody - C-terminal region (ARP50111_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FCRLA Antibody - C-terminal region (ARP50111_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FCRLA Antibody - C-terminal region (ARP50111_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FCRLA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FCRLA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FCRLA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FCRLA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FCRLA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FCRLA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FCRLA Antibody - C-terminal region (ARP50111_P050)
Your Rating
We found other products you might like!