EN1 Antibody - middle region (ARP38029_P050)

Catalog No: ARP38029_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EN1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%
• Peptide Sequence: Synthetic peptide located within the following region: LNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDES
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EN1 (ARP38029_P050) antibody is Catalog # AAP38029 (Previous Catalog # AAPP20205)
• Reference: Atit,R., (2006) Dev. Biol. 296 (1), 164-176

Target Info

• Gene Symbol: EN1
• Gene Full Name: Engrailed homeobox 1
• Alias Symbols: ENDOVESLB
• NCBI Gene Id: 2019
• Protein Name: Homeobox protein engrailed-1
• Description of Target: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Differe
• Uniprot ID: Q05925
• Protein Accession #: NP_001417
• Nucleotide Accession #: NM_001426
• Protein Size (# AA): 392
• Molecular Weight: 40 kDa
• Protein Interactions: TLE1; PAX6; JUN;