EGR1 Antibody - N-terminal region (ARP32241_P050)

Catalog No: ARP32241_P050

Host: Rabbit
Target Name: EGR1
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml

Immunohistochemistry with Colon, myenteric plexus tissue at an antibody concentration of 5.0ug/ml using anti-EGR1 antibody (ARP32241_P050)

Rabbit Anti-EGR1 Antibody
Catalog Number: ARP32241
Paraffin Embedded Tissue: Human Spleen
Cellular Data: Spleen cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Rabbit Anti-EGR1 Antibody
Catalog Number: ARP32241
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EGR1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 87%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EGR1 (ARP32241_P050) antibody is Catalog # AAP32241 (Previous Catalog # AAPP03222)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Yu,J., et al., (2004) Mol.Cell 15(1),83-94
• Publications:

  Barbolina, M. V, Adley, B. P., Ariztia, E. V, Liu, Y. & Stack, M. S. Microenvironmental regulation of membrane type 1 matrix metalloproteinase activity in ovarian carcinoma cells via collagen-induced EGR1 expression. J. Biol. Chem. 282, 4924-31 (2007). 17158885

  Jaluria, P., Konstantopoulos, K., Betenbaugh, M. & Shiloach, J. Egr1 and Gas6 facilitate the adaptation of HEK-293 cells to serum-free media by conferring enhanced viability and higher growth rates. Biotechnol. Bioeng. 99, 1443-52 (2008). 18023050

  Lane, K. R. et al. Cell cycle-regulated protein abundance changes in synchronously proliferating HeLa cells include regulation of pre-mRNA splicing proteins. PLoS One 8, e58456 (2013). 23520512

  Ohata, Y. et al. Elevated fibroblast growth factor 23 exerts its effects on placenta and regulates vitamin D metabolism in pregnancy of Hyp mice. J. Bone Miner. Res. 29, 1627-38 (2014). 24470103

  Temporal Analysis of Gene Expression in the Murine Schwann Cell Lineage and the Acutely Injured Postnatal Nerve. PLoS ONE. 11, e0153256 (2016). 27058953

  Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). 20368707

  Wenzel, K. et al. Expression of the protein phosphatase 1 inhibitor KEPI is downregulated in breast cancer cell lines and tissues and involved in the regulation of the tumor suppressor EGR1 via the MEK-ERK pathway. Biol. Chem. 388, 489-95 (2007). 17516844

Target Info

• Gene Symbol: EGR1
• Gene Full Name: Early growth response 1
• Alias Symbols: TIS8, AT225, G0S30, NGFI-A, ZNF225, KROX-24, ZIF-268
• NCBI Gene Id: 1958
• Protein Name: Early growth response protein 1
• Description of Target: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P18146
• Protein Accession #: NP_001955
• Nucleotide Accession #: NM_001964
• Protein Size (# AA): 543
• Molecular Weight: 58 kDa
• Protein Interactions: CEBPB; WT1; SUMO1; TP53; MDM2; EP300; CDKN2A; SRA1; IL1B; PTEN; SP1; SNAI1; TBX2; PFDN5; SREBF2; ERBB3; NAB2; PITX1; NAB1; NFATC2; CREBBP; PSMA3; JUN; RELA; CSNK2A1; NFATC1; GADD45B; GADD45A;