Hand2 antibody - C-terminal region (ARP30571_P050)

Catalog#: ARP30571_P050

• Size: 50ug

Mouse Heart

• Description of Target: Hand2 is essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. It is required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. It plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Hand2 is involved in the development of branchial arches, which give rise to unique structures in the head and neck.
• Gene Symbol: Hand2
• Official Gene Full Name: Heart and neural crest derivatives expressed transcript 2
• Alias Symbols: AI225906; AI661148; Ehand2; Hed; Th2; Thing2; bHLHa26; dHAND
• Protein Accession#: NP_034532
• Nucleotide Accession#: NM_010402
• Swissprot Id: Q61039
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 217
• Molecular Weight: 24kDa
• Application: WB
• Partner Proteins: Hand1, Twist1
• Immunogen: The immunogen for anti-Hand2 antibody: synthetic peptide corresponding to a region of Mouse
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; African clawed frog: 93%; Chicken: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ
• Blocking Peptide: For anti-Hand2 antibody is Catalog # AAP30571 (Previous Catalog # AAPP32996)
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-Hand2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.