ZMAT3 Antibody - N-terminal region (ARP50793_P050)

Catalog No: ARP50793_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-ZMAT3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZMAT3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: EQDCALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ZMAT3 (ARP50793_P050) antibody is Catalog # AAP50793 (Previous Catalog # AAPP13981)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Mendez (2006) FEBS Lett. 580 (18), 4401-4408

Target Info

• Gene Symbol: ZMAT3
• Gene Full Name: Zinc finger, matrin-type 3
• Alias Symbols: WIG1, WIG-1, PAG608
• NCBI Gene Id: 64393
• Protein Name: Zinc finger matrin-type protein 3
• Description of Target: ZMAT3 is a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway.This gene encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway. Alternative splicing of this gene results in two transcript variants encoding two isoforms differing in only one amino acid.
• Uniprot ID: Q9HA38
• Protein Accession #: NP_689426
• Nucleotide Accession #: NM_152240
• Protein Size (# AA): 289
• Molecular Weight: 32 kDa
• Protein Interactions: PRKRA; STAU1; SIAH1; APP; vpr; HNRNPA2B1; DHX9; ELAVL1; SNW1; SMARCA2; SUMO2;