SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP32422_P050
Price: $0.00
SKU
ARP32422_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ZEB1 (ARP32422_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZEB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGH
Concentration0.5 mg/ml
Blocking PeptideFor anti-ZEB1 (ARP32422_P050) antibody is Catalog # AAP32422 (Previous Catalog # AAPP03417)
Sample Type Confirmation

ZEB1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceGregory,P.A., (2008) Nat. Cell Biol. 10 (5), 593-601
Publications

Lobert, S., Graichen, M. E. & Morris, K. Coordinated regulation of beta-tubulin isotypes and epithelial-to-mesenchymal transition protein ZEB1 in breast cancer cells. Biochemistry 52, 5482-90 (2013). 23869586

Gene SymbolZEB1
Gene Full NameZinc finger E-box binding homeobox 1
Alias SymbolsBZP, TCF8, AREB6, FECD6, NIL2A, PPCD3, ZFHEP, ZFHX1A, DELTAEF1
NCBI Gene Id6935
Protein NameZinc finger E-box-binding homeobox 1
Description of TargetZEB1 is a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site.ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM].
Uniprot IDP37275
Protein Accession #NP_110378
Nucleotide Accession #NM_030751
Protein Size (# AA)1124
Molecular Weight124kDa
Protein InteractionsSUMO1; CDK6; GTF2A1; UBR4; SUMO2; SIRT1; SOX2; CTBP2; CTBP1; SMAD7; SMAD6; SMARCA4; SERPINH1; SMAD3; EP300; DRAP1; KAT5; SMAD2; SMAD1; CDH1;
  1. What is the species homology for "ZEB1 Antibody - N-terminal region (ARP32422_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "ZEB1 Antibody - N-terminal region (ARP32422_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZEB1 Antibody - N-terminal region (ARP32422_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZEB1 Antibody - N-terminal region (ARP32422_P050)"?

    This target may also be called "BZP, TCF8, AREB6, FECD6, NIL2A, PPCD3, ZFHEP, ZFHX1A, DELTAEF1" in publications.

  5. What is the shipping cost for "ZEB1 Antibody - N-terminal region (ARP32422_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZEB1 Antibody - N-terminal region (ARP32422_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZEB1 Antibody - N-terminal region (ARP32422_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "124kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZEB1 Antibody - N-terminal region (ARP32422_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZEB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZEB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZEB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZEB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZEB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZEB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZEB1 Antibody - N-terminal region (ARP32422_P050)
Your Rating
We found other products you might like!