Catalog No: ARP38864_P050
Price: $0.00
SKU
ARP38864_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ZBTB33 Antibody - N-terminal region (ARP38864_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ZBTB33 (ARP38864_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB33
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL
Concentration0.5 mg/ml
Blocking PeptideFor anti-ZBTB33 (ARP38864_P050) antibody is Catalog # AAP38864 (Previous Catalog # AAPP21071)
ReferenceDefossez,P.A., (2005) J. Biol. Chem. 280 (52), 43017-43023
Gene SymbolZBTB33
Gene Full Namezinc finger and BTB domain containing 33
Alias SymbolsZNF348, ZNF-kaiso
NCBI Gene Id10009
Protein Nametranscriptional regulator Kaiso
Description of TargetThis gene encodes a transcriptional regulator with bimodal DNA-binding specificity, which binds to methylated CGCG and also to the non-methylated consensus KAISO-binding site TCCTGCNA. The protein contains an N-terminal POZ/BTB domain and 3 C-terminal zinc finger motifs. It recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt signaling pathway, and may also activate transcription of a subset of target genes by the recruitment of catenin delta-2 (CTNND2). Its interaction with catenin delta-1 (CTNND1) inhibits binding to both methylated and non-methylated DNA. It also interacts directly with the nuclear import receptor Importin-α2 (also known as karyopherin alpha2 or RAG cohort 1), which may mediate nuclear import of this protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Uniprot IDQ86T24
Protein Accession #NP_006768
Nucleotide Accession #NM_006777
Protein Size (# AA)672
Molecular Weight74kDa
Protein InteractionsHUWE1; SUMO2; SUMO3; CBFA2T3; LMNA; UBC; TCF7L2; KPNA2; CTNND1; CTNNB1; CTCF; ELAVL1; CTNND2; WDR48; NCOR1; ZBTB33; HDAC3; WNT11; S100A4; MMP7;
  1. What is the species homology for "ZBTB33 Antibody - N-terminal region (ARP38864_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ZBTB33 Antibody - N-terminal region (ARP38864_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ZBTB33 Antibody - N-terminal region (ARP38864_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ZBTB33 Antibody - N-terminal region (ARP38864_P050)"?

    This target may also be called "ZNF348, ZNF-kaiso" in publications.

  5. What is the shipping cost for "ZBTB33 Antibody - N-terminal region (ARP38864_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ZBTB33 Antibody - N-terminal region (ARP38864_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ZBTB33 Antibody - N-terminal region (ARP38864_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "74kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ZBTB33 Antibody - N-terminal region (ARP38864_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ZBTB33"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ZBTB33"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ZBTB33"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ZBTB33"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ZBTB33"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ZBTB33"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ZBTB33 Antibody - N-terminal region (ARP38864_P050)
Your Rating